We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

TIRAP (TLR2 and TLR4) Inhibitor Peptide Set

Images

 
TIRAP (TLR2 and TLR4) Inhibitor Peptide [NBP2-26245] - TLR2 acts through formation of heterodimer complexes with TLR1 or TLR6. HEK 293 endogenously expresses TLR1 and TLR6, so that the TLR2 reporter cell line can ...read more
TIRAP (TLR2 and TLR4) Inhibitor Peptide [NBP2-26245] - The TLR4 reporter cell line responds to LPS. The TLR2 / TLR4 inhibitor specifically inhibits TLR4 activation upon LPS stimulation in a dose-response manner.
TIRAP (TLR2 and TLR4) Inhibitor Peptide [NBP2-26245] - TLR2 /4 Inhibitor suppressed the Pam3CSK4-induced TLR2/TLR1 activity [A] and the LPS-induced TLR4 activity [B] in a dose-response manner, of which IC50 values were ...read more

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications Flow, Func

Order Details

TIRAP (TLR2 and TLR4) Inhibitor Peptide Set Summary

Description
TLR2 / TLR4 Inhibitor Peptide: 1 mg (lyophilized); sequence: DRQIKIWFQNRRMKWKKPGFLRDPWCKYQML (Inhibitor sequence: PGFLRDPWCKYQML); Molecular weight: 4097.92 Da

Antennapedia Control Peptide: 1 mg (lyophilized); sequence: DRQIKIWFQNRRMKWKK; Molecular weight: 2361 Da
Specificity
TLR2 and TLR4 Inhibitor Peptide: COBRA
TLR2 and TLR4 Inhibitor interferes with interaction between TIRAP/Mal and TIR domain of TLR2 or TLR4.
Preparation
Method
Preparation of 2.5 mM peptide stock solutions
TLR2 / TLR4 Inhibitor Peptide: A final volume of 100 ul will make a 2.5 mM stock solution. Add 100 ul sterile water to the tube of peptide. Carefully pipet to ensure all of the peptide is dissolved and briefly spin the tube before opening.

Antennapedia Control Peptide: A final volume of 170 ul will make a 2.5 mM stock solution. Add 170 ul sterile water to the tube of peptide. Carefully pipet to ensure all of the peptide is dissolved and briefly spin the tube before opening.

The stock solutions may be diluted further to make working solutions. Dilute according to the needs for your assay. For example, dilute 2.5 mM stock solutions 1:10 in sterile 1X PBS or cell culture media to make 250 uM working solutions. Working solution should be made fresh daily and not be stored.
Gene
TIRAP

Applications/Dilutions

Dilutions
  • Flow Cytometry reported in scientific literature (PMID 27838489)
  • In vitro assay reported in scientific literature (PMID 26908090)
Application Notes
The inhibitor is used in assays to inhibit TLR2 and TLR4 signaling. We recommend an initial titration of the inhibitor from 0-50 uM for in vitro assays along with control of which concentrations should be mirror inhibitor concentrations. Inhibitor and control should be preincubated with cells prior to ligand activation to allow sufficient time for the peptides to enter from the media into the cell. We typically preincubate with inhibitor and control for 1 h prior to TLR2 or TLR4 activation (Figures 1 and 2); however, optimal preincubation times may vary between model systems. The TLR2/NF-kB/SEAPorter™ cell line and TLR4/MD2/CD14/NF-kB/SEAPorter™ cell line are a useful positive control model system for studying inhibition of TLR2 and TLR4 activation, respectively (Figures 1 through 3).
Publications
Read Publications using
NBP2-26245 in the following applications:

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
Form: White solid
Solubilize the peptides prior to use by preparing 2.5 mM stock solution in sterile water.

Alternate Names for TIRAP (TLR2 and TLR4) Inhibitor Peptide Set

  • adapter protein wyatt
  • Adaptor protein Wyatt
  • FLJ42305
  • Mal
  • MyD88 adapter-like protein
  • TIR domain-containing adapter protein
  • toll/interleukin-1 receptor domain-containing adapter protein
  • toll-interleukin 1 receptor (TIR) domain containing adaptor protein
  • Toll-interleukin 1 receptor (TIR) domain-containing adaptor protein
  • Toll-like receptor adaptor protein
  • wyatt

Background

TIRAP/Mal is an adapter protein in the signaling pathways activated by TLR2 and TLR4, and appears to be essential for MyD88-dependent TLR2 and TLR4 signaling pathways. TIRAP is recruited to activated TL2 and TLR4 through interaction with TIR domain of the receptor. This peptide contains a sequence from mouse TIRAP that blocks the function of TIRAP, likely through binding to the receptor and blocking TIR-TIR domain interaction between TIRAP and the receptor.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Inhibitors are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56566
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, In vitro, KD, KO, PAGE, Simple Western, WB
NBP2-29328
Species: Bv, Hu, Mu, Rt, Xp, Ye, Ze
Applications: BindInhib, B/N, ELISA, Flow, Func-Inh, IHC, In vitro, In vivo
NB100-56722
Species: Ca, Hu, Mu, Rb, Rt
Applications: B/N, DB, ELISA, Flow-CS, Flow, Func, ICC/IF, IP, In vitro, WB
NB120-13810
Species: Mu, Po, Rt
Applications: IB, ICC/IF, IHC,  IHC-P, IP, KD, Simple Western, WB
NBP2-24686
Species: Bv, Hu, Mu, Ma-Op, Pm, Rt
Applications: IHC,  IHC-P, WB
NB100-1207
Species: Hu, Mu
Applications: IHC,  IHC-P, PEP-ELISA, WB
M6000B
Species: Mu
Applications: ELISA
NBP2-24875
Species: Ca, Hu, Mu
Applications: BA, B/N, Flow-IC, Flow, ICC/IF, IHC,  IHC-P, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC,  IHC-P, KO, Simple Western, WB
NBP3-47457
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, WB
NBP3-13785
Species: Hu
Applications: ELISA, Flow, ICC/IF,  IHC-P, IP, PA, WB
201-LB
Species: Hu
Applications: BA
NBP1-88498
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
H00057152-M06
Species: Hu, Mu
Applications: ELISA, IHC-Fr, IP, WB
NBP2-69822
Species: Hu
Applications: ELISA
AF2254
Species: Mu
Applications: IHC, WB
NBP2-24729
Species: Ca, Eq, Hu, Pm, Mu, Pm, Rt
Applications: B/N, CyTOF-ready, DB, ELISA, Flow-IC, Flow, Func, ICC/IF, IHC,  IHC-P, IP, In vitro, KD, Simple Western, WB
NB100-56563
Species: Hu, Mu, Rt
Applications: DB, Flow-CS, Flow-IC, Flow, IHC,  IHC-P, WB
8499-IF
Species: Hu
Applications: BA
Supplier Logo

Publications for TIRAP (TLR2 and TLR4) Inhibitor (NBP2-26245)(8)

We have publications tested in 3 confirmed species: Human, Mouse, Bacteria.

We have publications tested in 2 applications: FLOW, In vitro.


Filter By Application
FLOW
(1)
In vitro
(1)
All Applications
Filter By Species
Human
(1)
Mouse
(1)
Bacteria
(1)
All Species
Showing Publications 1 - 8 of 8.
Publications using NBP2-26245 Applications Species
Wang N, Guo W, Liu T et al. Toll-like receptors (TLR2 and TLR4) antagonist mitigates the onset of cerebral small vessel disease through PI3K/Akt/GSK3? pathway in stroke-prone renovascular hypertensive rats Biotechnology & genetic engineering reviews 2023-03-06 [PMID: 36877597]
Lu HT, Lu JW, Lee CH et al. Attenuative Effects of Platelet-Rich Plasma on 30 kDa Fibronectin Fragment-Induced MMP-13 Expression Associated with TLR2 Signaling in Osteoarthritic Chondrocytes and Synovial Fibroblasts Journal of Clinical Medicine 2021-09-29 [PMID: 34640514]
Jing X, Min C, Qi Yun L et al. Toll-like receptor 2/4 inhibitors can reduce preterm birth in mice J Int Med Res 2020-10-01 [PMID: 33100071]
Yamaguchi M, Hirose Y, Takemura M, et al Streptococcus pneumoniae Evades Host Cell Phagocytosis and Limits Host Mortality Through Its Cell Wall Anchoring Protein PfbA. Front Cell Infect Microbiol. 2019-08-20 [PMID: 31482074] (Bacteria)

Details:
Mice were infected with S. pneumoniae.
Bacteria
Martinez-Mendez D, Rivera-Toledo E, Ortega E et al. Monocyte-lymphocyte fusion induced by the HIV-1 envelope generates functional heterokaryons with an activated monocyte-like phenotype. Exp. Cell Res. 2017-03-01 [PMID: 28132881]
Cheng Y, Xiong J, Chen Q et al. Hypoxia/reoxygenation-induced HMGB1 translocation and release promotes islet proinflammatory cytokine production and early islet graft failure through TLRs signaling. Biochim. Biophys. Acta. 2016-11-10 [PMID: 27838489] (FLOW, Mouse) FLOW Mouse
Pahwa R, Nallasamy P, Jialal I. Toll-like receptors 2 and 4 mediate Hyperglycemia induced Macrovascular Aortic Endothelial Cell Inflammation and Perturbation of the Endothelial Glycocalyx. J Diabetes Complications. 2016-01-22 [PMID: 26908090] (In vitro, Human) In vitro Human
Couture LA, Piao W, Ru LW et al. Targeting Toll-like receptor (TLR) signaling by Toll/interleukin-1 receptor (TIR) domain-containing adapter protein/MyD88 adapter-like (TIRAP/Mal)-derived decoy peptides. J Biol Chem. 2012-07-13 [PMID: 22648407]

Reviews for TIRAP (TLR2 and TLR4) Inhibitor (NBP2-26245) (0)

There are no reviews for TIRAP (TLR2 and TLR4) Inhibitor (NBP2-26245). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TIRAP (TLR2 and TLR4) Inhibitor (NBP2-26245). (Showing 1 - 2 of 2 FAQs).

  1. What is the advantage of NBP2-26245 over NBP2-29331? Both of them are TIRAP Inhibitory Peptides but I do not see in the literature provided in the webepage why I would choose one over the other? Or why would I spend more on NBP2-26245?
    • While both of these peptides serve the same function, there are differences in the functional sequence. I would like to direct you to to two attached articles in regards to this. 1. NBP2-26245 (Piao, 2013), sequence is shown in Figure 3G, labelled as mTIRAP 2. NBP2-29331: (Shilling 2002), sequence is described under Reagents and Abs on page 5875. All things aside, we have extensive testing data for NBP2-26245 from in-house testing, whereas we are still in the process of validating NBP2-29331 in-house. We can offer much better support for NBP2-26245 so this is the product I would recommend.
  2. Our customer has a question about NBP2-26245. Inhibitors are guaranteed for 1 year from date of receipt is described on the product page. However, the customer said that their project may last longer, and they cannot ensure when the product will be applied. Would you please help check and suggest the expiry date of the newest lot of NBP2-26245?
    • We do not state expiry dates on our products however, as you rightly point out, our TIRAP (TLR2 and TLR4) inhibitor peptide set with catalogue number NBP2-26245 is guaranteed for 1 year from the date of receipt. Upon receipt of the product I recommend that your customer stores it in its lyophilised form at -20C or -80C until they actually need to use it, since lyophilised products are more stable than liquids. Upon reconstitution they should aliquot the product and store it at -20C or -80C, avoiding freeze-thaw cycles. We do not have any testing data regarding the stability of this product beyond a year and cannot guarantee it beyond this time.

Additional TIRAP (TLR2 and TLR4) Products

Research Areas for TIRAP (TLR2 and TLR4) Inhibitor (NBP2-26245)

Find related products by research area.

Blogs on TIRAP (TLR2 and TLR4)

There are no specific blogs for TIRAP (TLR2 and TLR4), but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Review this Product

Be the first to review our TIRAP (TLR2 and TLR4) Inhibitor Peptide Set and receive a gift card or discount.

Bioinformatics

Gene Symbol TIRAP