Tollip Antibody - BSA Free

Western Blot: Tollip Antibody [NBP1-81596] - Analysis in U-87MG ATCC cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented. Loading control: Anti-PPIB.

Immunohistochemistry-Paraffin: Tollip Antibody [NBP1-81596] - Staining of human testis.

Western Blot: Tollip Antibody [NBP1-81596] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)

Immunohistochemistry-Paraffin: Tollip Antibody [NBP1-81596] - Staining of human cerebral cortex, epididymis, liver and testis using Anti-TOLLIP antibody NBP1-81596 (A) shows similar protein distribution across tissues to independent antibody NBP1-81597 (B).

Immunohistochemistry-Paraffin: Tollip Antibody [NBP1-81596] - Staining of human liver.

Immunohistochemistry-Paraffin: Tollip Antibody [NBP1-81596] - Staining of human cerebral cortex.

Immunohistochemistry-Paraffin: Tollip Antibody [NBP1-81596] - Staining of human epididymis.

• Reactivity: Hu, Rt, Mu
• Applications: WB, IHC, KD
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Tollip Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VVQAKLAKNYGMTRMDPYCRLRLGYAVYETPTAHNGAKNPRWNKVIHCTVPPGVDSFYLEIFDERAFSMDDRIAWTHITIPES
• Predicted Species: Mouse (99%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TOLLIP
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Theoretical MW: 30 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  Tollip Protein (NBP1-81596PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Tollip Antibody - BSA Free

• adapter protein
• FLJ33531
• IL-1RAcPIP
• toll interacting protein
• toll-interacting protein
• Tollip

Background

TOLLIP is a ubiquitin-binding protein that interacts with several components of the Toll-like receptor (TLR; see MIM 603030) signaling cascade. It is an essential regulator of inflammatory signaling and is involved in trafficking of interleukin-1 receptor (IL1R; MIM 147810) and turnover of IL1R-associated kinase (IRAK, or IRAK1; MIM 300283) (summary by Lo et al., 2009 (PubMed 19444506)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TOLLIP
• Entrez:
  • 54472(Human)
• Uniprot:
  • Q9H0E2(Human)