TLR6 Antibody


Immunocytochemistry/ Immunofluorescence: TLR6 Antibody [NBP2-57646] - Staining of human cell line A549 shows localization to endoplasmic reticulum.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF

Order Details

TLR6 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:FKVGLMTKDMPSLEILDVSWNSLESGRHKENCTWVESIVVLNLSSNMLTD
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TLR6 Recombinant Protein Antigen (NBP2-57646PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, pH 7.2, containing 40% glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for TLR6 Antibody

  • CD286 antigen
  • CD286
  • TLR6
  • toll-like receptor 6


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Ca
Applications: WB, B/N, Flow, Func, ICC/IF, IHC-P, IP, Flow-CS
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC
Species: Hu, Mu, Rt, Ca, Eq, Pm
Applications: WB, Simple Western, ELISA, Flow, Func, ICC/IF, IHC, IHC-P, IP, In vitro, CyTOF-ready, Flow-IC
Species: Hu, Mu, Ca
Applications: WB, Flow, IHC, IHC-Fr, IHC-P, Flow-CS, Flow-IC
Species: Hu, Mu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC, IF
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
Species: Hu, Mu, Rt, Xp, Ye, Ze
Applications: ELISA
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC-P, CyTOF-ready, Flow-IC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC

Publications for TLR6 Antibody (NBP2-57646) (0)

There are no publications for TLR6 Antibody (NBP2-57646).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TLR6 Antibody (NBP2-57646) (0)

There are no reviews for TLR6 Antibody (NBP2-57646). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TLR6 Antibody (NBP2-57646) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional TLR6 Products

Bioinformatics Tool for TLR6 Antibody (NBP2-57646)

Discover related pathways, diseases and genes to TLR6 Antibody (NBP2-57646). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TLR6 Antibody (NBP2-57646)

Discover more about diseases related to TLR6 Antibody (NBP2-57646).

Pathways for TLR6 Antibody (NBP2-57646)

View related products by pathway.

PTMs for TLR6 Antibody (NBP2-57646)

Learn more about PTMs related to TLR6 Antibody (NBP2-57646).

Research Areas for TLR6 Antibody (NBP2-57646)

Find related products by research area.

Blogs on TLR6.

Exploring Various Studies on TLR6 Expression
The protein TLR6 is one member of the large Toll-like receptor (TLR) family, which governs the activation of the innate immunity system and pathogen recognition in cells. The TLR family is highly conserved from Drosophila to humans, and all the family...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TLR6 Antibody and receive a gift card or discount.


Gene Symbol TLR6