TIF1 alpha Antibody - BSA Free

Western Blot: TIF1 alpha Antibody [NBP1-92506] - Analysis in Caco-2 cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented. Loading control: Anti-GAPDH.

Immunocytochemistry/Immunofluorescence: TIF1 alpha Antibody [NBP1-92506] - Staining of human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: TIF1 alpha Antibody [NBP1-92506] - Staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: TIF1 alpha Antibody [NBP1-92506] - Staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts while additional moderate cytoplasmic in Leydig cells.

Immunohistochemistry-Paraffin: TIF1 alpha Antibody [NBP1-92506] - Staining of human small intestine shows moderate nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: TIF1 alpha Antibody [NBP1-92506] - Staining of human placenta shows moderate nuclear and weak cytoplasmic positivity in trophoblastic cells.

Analysis in Caco-2 cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented. Loading control: Anti-GAPDH.

Staining of human prostate shows moderate nuclear positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, Mycoplasma
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TIF1 alpha Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TIF1 alpha Antibody - BSA Free (NBP1-92506) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-TIF1 alpha Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SSPVGGSYNLPSLPDIDCSSTIMLDNIVRKDTNIDHGQPRPPSNRTVQSPNSSVPSPGLAGPVTMTSVHPPIRSPSA
• Predicted Species: Mouse (94%), Rat (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TRIM24
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  TIF1 alpha Protein (NBP1-92506PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for TIF1 alpha Antibody - BSA Free

• E3 ubiquitin-protein ligase TRIM24
• EC 6.3.2
• EC 6.3.2.-
• hTIF1
• PTC6
• RING finger protein 82
• RNF82
• RNF82Tif1a
• TIF1 alpha
• TIF1
• TIF1A
• TIF1-alpha
• TIF1ATIF1ALPHA
• TIF1TF1A
• transcription intermediary factor 1-alpha
• transcriptional intermediary factor 1
• TRIM24
• tripartite motif containing 24
• tripartite motif-containing 24
• Tripartite motif-containing protein 24

Background

TIF1 alpha is encoded by this gene mediates transcriptional control by interaction with the activation function 2 (AF2) region of several nuclear receptors, including the estrogen, retinoic acid, and vitamin D3 receptors. The protein localizes to nuclear bodies and is thought to associate with chromatin and heterochromatin-associated factors. The protein is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains - a RING, a B-box type 1 and a B-box type 2 - and a coiled-coil region. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TIF1 alpha Antibody (NBP1-92506)(1)

Publication using NBP1-92506

• Theurillat JP, Udeshi ND, Errington WJ et al. Ubiquitylome analysis identifies dysregulation of effector substrates in SPOP-mutant prostate cancer. Science 2014-10-03 [PMID: 25278611] (IF/IHC)

Bioinformatics

• Gene Symbol: TRIM24