TRIM17 Antibody (2E11)

Images

 
Immunocytochemistry/ Immunofluorescence: TRIM17 Antibody (2E11) [H00051127-M01] - Analysis of monoclonal antibody to TRIM17 on HeLa cell. Antibody concentration 10 ug/ml.
Sandwich ELISA: TRIM17 Antibody (2E11) [H00051127-M01] - Detection limit for recombinant GST tagged TRIM17 is 0.03 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, PLA, S-ELISA
Clone
2E11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

TRIM17 Antibody (2E11) Summary

Immunogen
TRIM17 (NP_057186.1, 75 a.a. ~ 184 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LPNRLLTKVAEMAQQHPGLQKQDLCQEHHEPLKLFCQKDQSPICVVCRESREHRLHRVLPAEEAVQGYKLKLEEDMEYLREQITRTGNLQAREEQSLAEWQGKVKERRER
Specificity
TRIM17 - tripartite motif-containing 17 (2E11)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TRIM17
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Proximity Ligation Assay
  • Sandwich ELISA
Application Notes
Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Publications
Read Publication using H00051127-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TRIM17 Antibody (2E11)

  • E3 ubiquitin-protein ligase TRIM17
  • EC 6.3.2.-
  • RBCCRNF16terf
  • RING finger protein 16
  • RING finger protein terf
  • TERF
  • Testis RING finger protein
  • tripartite motif containing 17
  • tripartite motif-containing 17
  • Tripartite motif-containing protein 17

Background

The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. The protein is expressed almost exclusively in the testis, but its function is unknown. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4708
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
NBP3-05061
Species: Hu, Mu
Applications: WB, ICC/IF
NB100-2596
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-P, IP, CHIP-SEQ
NB100-2350
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-82787
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88301
Species: Hu, Mu
Applications: WB, IB
NB100-59787
Species: Hu, Mu
Applications: WB, Flow, IB, ICC/IF, IHC, IHC-P, IP, PLA, KD
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-31361
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NBP2-66987
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP2-20711
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1556
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
NBP1-85016
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-49536
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-29421
Species: Hu, Rt, Po, Bv, Gt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00055521-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA

Publications for TRIM17 Antibody (H00051127-M01)(1)

Reviews for TRIM17 Antibody (H00051127-M01) (0)

There are no reviews for TRIM17 Antibody (H00051127-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TRIM17 Antibody (H00051127-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TRIM17 Products

Bioinformatics Tool for TRIM17 Antibody (H00051127-M01)

Discover related pathways, diseases and genes to TRIM17 Antibody (H00051127-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRIM17 Antibody (H00051127-M01)

Discover more about diseases related to TRIM17 Antibody (H00051127-M01).
 

Pathways for TRIM17 Antibody (H00051127-M01)

View related products by pathway.

PTMs for TRIM17 Antibody (H00051127-M01)

Learn more about PTMs related to TRIM17 Antibody (H00051127-M01).
 

Research Areas for TRIM17 Antibody (H00051127-M01)

Find related products by research area.

Blogs on TRIM17

There are no specific blogs for TRIM17, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRIM17 Antibody (2E11) and receive a gift card or discount.

Bioinformatics

Gene Symbol TRIM17
Entrez
Uniprot