Home » TRIM17 » TRIM17 Research Products » TRIM17 Antibody (2E11)

TRIM17 Antibody (2E11)

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Immunocytochemistry/Immunofluorescence: TRIM17 Antibody (2E11) [H00051127-M01] - Analysis of monoclonal antibody to TRIM17 on HeLa cell. Antibody concentration 10 ug/ml.
Immunocytochemistry/ Immunofluorescence: TRIM17 Antibody (2E11) [H00051127-M01] - Analysis of monoclonal antibody to TRIM17 on HeLa cell. Antibody concentration 10 ug/ml.
Sandwich ELISA: TRIM17 Antibody (2E11) [H00051127-M01] - Detection limit for recombinant GST tagged TRIM17 is 0.03 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, PLA, S-ELISA
Clone
2E11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

TRIM17 Antibody (2E11) Summary

Immunogen
TRIM17 (NP_057186.1, 75 a.a. ~ 184 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LPNRLLTKVAEMAQQHPGLQKQDLCQEHHEPLKLFCQKDQSPICVVCRESREHRLHRVLPAEEAVQGYKLKLEEDMEYLREQITRTGNLQAREEQSLAEWQGKVKERRER
Specificity
TRIM17 - tripartite motif-containing 17 (2E11)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TRIM17
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Proximity Ligation Assay
  • Sandwich ELISA
Application Notes
Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Publications
Read Publication using H00051127-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TRIM17 Antibody (2E11)

  • E3 ubiquitin-protein ligase TRIM17
  • EC 6.3.2.-
  • RBCCRNF16terf
  • RING finger protein 16
  • RING finger protein terf
  • TERF
  • Testis RING finger protein
  • tripartite motif containing 17
  • tripartite motif-containing 17
  • Tripartite motif-containing protein 17

Background

The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. The protein is expressed almost exclusively in the testis, but its function is unknown. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

TRIM Antibody
[Unconjugated]
AF4708
Western blot shows lysates of human peripheral blood mononuclear cells and Jurkat human acute T cell leukemia cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human TRIM Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4708) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for TRIM at approximately 27 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
Human CD3+ T cells from peripheral blood mononuclear cells were stained with Goat Anti-Human TRIM Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4708, filled histo­gram) or isotype control antibody (Catalog #AB-108-C, open histo­gram), followed by Phycoerythrin-conjugated Anti-Goat IgG Secondary Antibody (Catalog # F0107). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
MID1 Antibody
NBP3-05061
Western Blot: MID1 Antibody [NBP3-05061] - analysis of extracts of HeLa cells, using MID1 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 60s.
Immunocytochemistry/Immunofluorescence: MID1 Antibody [NBP3-05061] - Analysis of MCF-7 cells using MID1 antibody. Blue: DAPI for nuclear staining.
Western Blot: MID1 Antibody [NBP3-05061] - Analysis of extracts of various cell lines, using MID1 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit
Species: Hu, Mu
Applications: WB, ICC/IF
TIF1 alpha Antibody
NB100-2596
Western Blot: TIF1 alpha Antibody [NB100-2596] - Detection of Human and Mouse TIF1 Alpha/TRIM24 by Western Blot. Samples: Whole cell lysate (50 ug) from HeLa, 293T, Jurkat, mouse TCMK-1, and mouse NIH3T3 cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-TIF1 Alpha/TRIM24 antibody NB100-2596 used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
Immunohistochemistry-Paraffin: TIF1 alpha Antibody [NB100-2596] - Section of mouse teratoma. Antibody: Affinity purified rabbit anti-TIF1alpha/TRIM24 used at a dilution of 1:200 (1ug/ml). Detection: DAB
Chromatin Immunoprecipitation Sequencing: TIF1 alpha Antibody [NB100-2596] - Localization of TIF1 Alpha/TRIM24 Binding Sites by ChIP-sequencing.Chromatin from Breast cancer cell line T47D was immunoprecipitated with anti-TIF1 Alpha/TRIM24 antibody NB100-2596 and analyzed by DNA sequencing. The figure illustrates the peak distribution of TIF1 Alpha/TRIM24 binding within a 250 Kb region of chromosome 19 as detected using anti-TIF1 Alpha/TRIM24 antibody NB100-2596. ChIP-seq validation performed by Active Motif, Carlsbad, CA.
(3 Publications)
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-P, IP, CHIP-SEQ
KAP1 [p Ser824]
Antibody
NB100-2350
Western Blot: KAP1 [p Ser824] Antibody [NB100-2350] - MDA-MB-231 cells were treated with DMSO or Merbarone (100 uM) for 24 hours, whole cell lysates were loaded with 50 ug/lane. 10% SDS-PAGE. KAP1 [p Ser824] Antibody (NB100-2350) primary antibody at 1:1000, 4C, overnight. Western blot image submitted by a verified customer review.
Immunocytochemistry/Immunofluorescence: KAP1 [p Ser824] Antibody [NB100-2350] - NBF-fixed asynchronous HeLa cells grown in chambered microscope slides and treated with EPE (left) or untreated (right). Antibody: Affinity purified rabbit anti-Phospho KAP-1 (S824) used at a dilution of 1:200 (1ug/ml). Detection: Red fluorescent Anti-rabbit IgG-DyLight (R) 594 conjugated used at a dilution of 1:100.
Immunohistochemistry-Paraffin: KAP1 [p Ser824] Antibody [NB100-2350] - Human Phospho Kap1 (S824) by Immunohistochemistry. Sample: FFPE serial section of human lung cancer used at a dilution of 1:200 (1 ug/ml). Detection: DAB
(1 Review)
(31 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
MPG Antibody
NBP1-82787
Western Blot: MPG Antibody [NBP1-82787] - Analysis in human cell lines MCF-7 and HeLa. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.
Immunocytochemistry/Immunofluorescence: MPG Antibody [NBP1-82787] - Staining of human cell line U-251 MG shows localization to nucleoplasm and cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: MPG Antibody [NBP1-82787] - Staining of human cerebral cortex shows strong nuclear and cytoplasmic positivity in neuronal cells.
(2 Reviews)
(2 Publications)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
RBCK1 Antibody
NBP1-88301
Western Blot: RBCK1 Antibody [NBP1-88301] - Analysis in human cell lines SK-MEL-30 and HeLa using anti-RBCK1 antibody. Corresponding RBCK1 RNA-seq data are presented for the same cell lines. Loading control: anti-PFN1.
(1 Review)
(10 Publications)
Species: Hu, Mu
Applications: WB, IB
PML Protein
Antibody
NB100-59787
Western Blot: PML Protein Antibody [NB100-59787] - Detection of Human PML on HeLa whole cell lysate using NB100-59787. PML was also immunoprecipitated by rabbit anti-PML antibodies NB100-59788 and another CDC16/APC6 Ab.
Immunohistochemistry-Paraffin: PML Protein Antibody [NB100-59787] - IHC analysis of a formalin fixed and paraffin embedded tissue section of human stomach using 1:50 dilution of PML antibody. The signal was developed using HRP-labeled secondary with DAB reagent followed by hematoxylin counterstaining. This antibody generated an expected strong nuclear staining in most of the cells in the glandular as well as the connective tissue. The cells showed some cytoplasmic signal also which was much weaker than the nuclear staining.
Immunohistochemistry-Paraffin: PML Protein Antibody [NB100-59787] - FFPE section of human breast carcinoma. Affinity purified rabbit anti-PML used at a dilution of 1:500
(1 Review)
(27 Publications)
Species: Hu, Mu
Applications: WB, Flow, IB, ICC/IF, IHC, IHC-P, IP, PLA, KD
ZNF645 Antibody
NBP2-21037
Western Blot: ZNF645 Antibody [NBP2-21037] - Sample (30 ug of whole cell lysate) A: MCF-7 10% SDS PAGE gel, diluted at 1:500.
Immunohistochemistry-Paraffin: ZNF645 Antibody [NBP2-21037] - Immunohistochemical analysis of paraffin-embedded GASTRIC CA, using antibody at 1:500 dilution.
Species: Hu
Applications: WB, IHC, IHC-P
MUL1 Antibody
(5H6.2D5)
NBP2-31361
Western Blot: MUL1 Antibody (5H6.2D5) [NBP2-31361] - WB detection of partial recombinant protein MUL1 by using MUL1 antibody (clone 5H6.2D5) at a concentration of 0.01 ug/ml.
Immunohistochemistry-Paraffin: MUL1 Antibody (5H6.2D5) [NBP2-31361] - IHC-P analysis of MUL1 protein in a transverse section of normal skeletal muscle from human using 5 ug/ml concentration of MUL1 antibody (clone 5H6.2D5). The myocytes and blood capillaries depicted strong staining whereas the nuclei were found negative for MUL1.
Immunohistochemistry-Paraffin: MUL1 Antibody (5H6.2D5) [NBP2-31361] - IHC-P analysis of MUL1 protein in a section of normal prostate from human using 5 ug/ml concentration of MUL1 antibody (clone 5H6.2D5). Strong cytoplasmic staining was observed in the epithelial columnar and basal cells of prostate glands.
Species: Hu
Applications: WB, IHC, IHC-P
TRIM50 Antibody
NBP1-81988
Immunohistochemistry-Paraffin: TRIM50 Antibody [NBP1-81988] - Staining of human bone marrow shows strong cytoplasmic positivity in a subset of bone marrow poietic cells.
Species: Hu
Applications: IHC, IHC-P
Coagulation Factor
XIV/Protein C Antibod ...
NBP2-66987
Immunocytochemistry/Immunofluorescence: Coagulation Factor XIV/Protein C Antibody (JM93-61) [NBP2-66987] - Staining Protein C in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: Coagulation Factor XIV/Protein C Antibody (JM93-61) [NBP2-66987] - Analysis of paraffin-embedded human liver tissue using anti-Protein C antibody. Counter stained with hematoxylin.
Immunocytochemistry/Immunofluorescence: Coagulation Factor XIV/Protein C Antibody (JM93-61) [NBP2-66987] - Staining Protein C in 293T cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
ALDH9A1 Antibody
NBP1-89150
Western Blot: ALDH9A1 Antibody [NBP1-89150] - Analysis in rat cell line NBT-II.
Immunohistochemistry-Paraffin: ALDH9A1 Antibody [NBP1-89150] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Western Blot: ALDH9A1 Antibody [NBP1-89150] - Analysis in human cell line TD47D.
(3 Publications)
Species: Hu, Rt
Applications: WB, IHC, IHC-P
ILT6/CD85e/LILRA3
Antibody (2E9)
H00011026-M01
Western Blot: ILT6/CD85e/LILRA3 Antibody (2E9) [H00011026-M01] - Analysis of LILRA3 expression in transfected 293T cell line by LILRA3 monoclonal antibody (M01), clone 2E9.Lane 1: LILRA3 transfected lysate(50.485 KDa).Lane 2: Non-transfected lysate.
(5 Publications)
Species: Hu
Applications: WB, ELISA
TRIM27 Antibody
NBP2-20711
Western Blot: TRIM27 Antibody [NBP2-20711] - TRIM27 antibody detects TRIM27 protein by western blot analysis. Various whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with TRIM27 antibody diluted at a dilution of 1:500.
Immunocytochemistry/Immunofluorescence: TRIM27 Antibody [NBP2-20711] - Confocal immunofluorescence analysis of paraformaldehyde-fixed HeLa, using TRIM27 antibody (Green) at 1:500 dilution. Alpha-tubulin filaments are labeled with Alpha-tubulin antibody (Red) at 1:2000.
Western Blot: TRIM27 Antibody [NBP2-20711] - Expression in transfected 293T cell line by TRIM27 polyclonal antibody. A: Non-transfected lysate. B: TRIM27 transfected lysate. 7. 5% SDS PAGE gel, diluted at 1:500.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP
Dihydrolipoamide
Dehydrogenase/DLD Ant ...
NBP1-31302
Western Blot: Dihydrolipoamide Dehydrogenase/DLD Antibody [NBP1-31302] - Wild-type (WT) and DLD knockout (KO) HeLa cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with DLD antibody diluted at 1:500. HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: Dihydrolipoamide Dehydrogenase/DLD Antibody [NBP1-31302] - HeLa cells were fixed in ice-cold MeOH for 5 min. Green: DLD protein stained by DLD antibody diluted at 1:500. Blue: Hoechst 33342 staining.
Immunohistochemistry-Paraffin: Dihydrolipoamide Dehydrogenase/DLD Antibody [NBP1-31302] - Human gastric cancer, using DLD antibody at 1:100 dilution. Antigen Retrieval: Trilogy™ (EDTA based, pH 8.0) buffer, 15min.
(1 Review)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Podocalyxin Like
Antibody
AF1556
Western blot shows lysates of mouse kidney tissue. PVDF membrane was probed with 1 µg/mL of Goat Anti-Mouse Podocalyxin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1556) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for Podocalyxin at approximately 130 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Podocalyxin was detected in perfusion fixed frozen sections of mouse thymus using Goat Anti-Mouse Podocalyxin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1556) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling when primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. Specific staining was localized to high endothelial venules. View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
(5 Reviews)
(30 Publications)
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
TRIM13 Antibody
NBP1-85016
Western Blot: TRIM13 Antibody [NBP1-85016] - Analysis in control (vector only transfected HEK293T lysate) and TRIM13 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: TRIM13 Antibody [NBP1-85016] - Staining of human testis shows moderate dot-like cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: TRIM13 Antibody [NBP1-85016] - Analysis in human testis and pancreas tissues. Corresponding TRIM13 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: WB, IHC, IHC-P
Pyruvate
Carboxylase Antibody
NBP1-49536
Western Blot: Pyruvate Carboxylase Antibody [NBP1-49536] - Analysis of Pyruvate Carboxylase in A. Human liver extracts and B. Mouse liver extracts
Immunocytochemistry/Immunofluorescence: Pyruvate Carboxylase Antibody [NBP1-49536] - HeLa cells were fixed in 4% paraformaldehyde for 10 min and permeabilized in 0.05% Triton X-100 in PBS for 5 minutes. The cells were incubated with anti- (NBP1-49536) at 10 ug/ml overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:500 dilution for 60 minutes. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 100X objective and digitally deconvolved.
Immunohistochemistry-Paraffin: Pyruvate Carboxylase Antibody [NBP1-49536] - IHC analysis of a formalin fixed and paraffin embedded tissue section of mouse kidney using rabbit anti-Pyruvate Carboxylase antibody at 1:200 dilution. The signal was developed using HRP conjugated anti-rabbit secondary antibody and DAB reagent. The nuclei were counterstained using hematoxylin. This Pyruvate Carboxylase antibody generated a diffused cytoplasmic staining in all the tubules and a subset of cells in glomerular cells.
(10 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
Cytokeratin 17
Antibody (E3 (same as ...
NBP2-29421
Western Blot: Cytokeratin 17 Antibody (E3 (same as Ks17.E3)) [NBP2-29421] - Analysis of Cytokeratin 17 in human HeLa lysate using Cytokeratin 17 E3 antibody at 3 ug/ml. goat anti-mouse Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.
Immunocytochemistry/Immunofluorescence: Cytokeratin 17 Antibody (E3 (same as Ks17.E3)) [NBP2-29421] - Formalin-paraffin skin stained with CK17 Ab (E3).
Immunohistochemistry-Paraffin: Cytokeratin 17 Antibody (E3 (same as Ks17.E3)) [NBP2-29421] - Formalin-paraffin skin stained with CK17 Ab (E3).
(2 Publications)
Species: Hu, Rt, Po, Bv, Gt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
RNF98 Antibody
(2D11)
H00055521-M01
Western Blot: RNF98 Antibody (2D11) [H00055521-M01] - TRIM36 monoclonal antibody (M01), clone 2D11 Analysis of TRIM36 expression in IMR-32.
Immunocytochemistry/Immunofluorescence: RNF98 Antibody (2D11) [H00055521-M01] - Analysis of monoclonal antibody to TRIM36 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: RNF98 Antibody (2D11) [H00055521-M01] - Analysis of monoclonal antibody to TRIM36 on formalin-fixed paraffin-embedded human pancreas. Antibody concentration 3 ug/ml.
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA

Publications for TRIM17 Antibody (H00051127-M01)(1)


Reviews for TRIM17 Antibody (H00051127-M01) (0)

There are no reviews for TRIM17 Antibody (H00051127-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TRIM17 Antibody (H00051127-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional TRIM17 Products

Bioinformatics Tool for TRIM17 Antibody (H00051127-M01)

Discover related pathways, diseases and genes to TRIM17 Antibody (H00051127-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRIM17 Antibody (H00051127-M01)

Discover more about diseases related to TRIM17 Antibody (H00051127-M01).
 

Pathways for TRIM17 Antibody (H00051127-M01)

View related products by pathway.

PTMs for TRIM17 Antibody (H00051127-M01)

Learn more about PTMs related to TRIM17 Antibody (H00051127-M01).
 

Research Areas for TRIM17 Antibody (H00051127-M01)

Find related products by research area.

Blogs on TRIM17

There are no specific blogs for TRIM17, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRIM17 Antibody (2E11) and receive a gift card or discount.


Bioinformatics

Gene Symbol TRIM17
Entrez
Uniprot