TIF1 gamma Antibody - BSA Free

Immunohistochemistry-Paraffin: TIF1 gamma Antibody [NBP1-83747] - Staining in human placenta and skeletal muscle tissues using NBP1-83747 antibody. Corresponding TRIM33 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: TIF1 gamma Antibody [NBP1-83747] - Staining of human cerebellum shows strong nuclear positivity in cells in granular layer.

Immunohistochemistry-Paraffin: TIF1 gamma Antibody [NBP1-83747] - Staining of human placenta shows strong nuclear positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: TIF1 gamma Antibody [NBP1-83747] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Immunohistochemistry-Paraffin: TIF1 gamma Antibody [NBP1-83747] - Staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.

Staining of human cell line U-251 MG shows localization to nucleoplasm.

Analysis in human cell lines MCF-7 and HeLa using Anti-TRIM33 antibody. Corresponding TRIM33 RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TIF1 gamma Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MQPHLQRQHSNPGHAGPFPVVSVHNTTINPTSPTTATMANANRGPTSPSVTAIELIPSVTNPENLPSLPDIPPIQLEDAGSSSLDNLLSRYISGSHLPPQPTSTMNPSPGPSALSPGSSGLSNSHTPVRPPSTSSTGSR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TRIM33
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation/Permeabilization: PFA/Triton X-100.
• Control Peptide:

  TIF1 gamma Recombinant Protein Antigen (NBP1-83747PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TIF1 gamma Antibody - BSA Free

• E3 ubiquitin-protein ligase TRIM33
• EC 6.3.2
• EC 6.3.2.-
• Ectodermin homolog
• KIAA1113
• Protein Rfg7
• PTC7FLJ32925
• RET-fused gene 7 protein
• RFG7FLJ11429
• TF1G
• TIF1GAMMA
• TIF1-gamma
• TIF1GECTO
• TIFGAMMA
• Transcription intermediary factor 1-gamma
• transcriptional intermediary factor 1 gamma
• tripartite motif containing 33
• tripartite motif-containing 33
• Tripartite motif-containing protein 33

Background

TIF1 gamma is encoded by this gene is thought to be a transcriptional corepressor. However, molecules that interact with this protein have not yet been identified. The protein is a member of the tripartite motif family. This motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. Three alternatively spliced transcript variants for this gene have been described, however, the full-length nature of one variant has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TRIM33