RIP140 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: RIP140 Antibody [NBP2-13674] - Staining of human cell line U-2 OS shows positivity in cell junctions & nucleus but excluded from the nucleoli.
Immunohistochemistry-Paraffin: RIP140 Antibody [NBP2-13674] - Staining of human kidney shows moderate nuclear positivity in renal tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RIP140 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SSEAHLQQYSREHALKTQNANQAASERLAAMARLQENGQKDVGSYQLPKG MSSHLNGQARTSSSKLMASKSSATVFQNPMGIIPSSPKNAGYKNSLERNN IKQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NRIP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RIP140 Protein (NBP2-13674PEP)
Reviewed Applications
Read 1 Review rated 4
using
NBP2-13674 in the following applications:

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RIP140 Antibody

  • 10RIP140Receptor-interacting protein 140
  • FLJ77253
  • nuclear receptor interacting protein 1
  • nuclear receptor-interacting protein 1
  • receptor interacting protein 140

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-310
Species: Hu, Mu, Rt, Mk
Applications: WB, ChIP, IP, IF
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-1756
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB100-58824
Species: Hu, Mu
Applications: WB, ChIP, IP, PLA
NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
NB120-2781
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-Fr
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB200-322
Species: Hu, Mu, Rt
Applications: WB, IHC-Fr
NB100-128
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P
H00008850-M04
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-58922
Species: Hu
Applications: WB
NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
NBP1-77077
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-314
Species: Hu
Applications: WB, IP, PLA
NBP1-76729
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27203
Species: Hu, Mu, Rt, Po, Ch, ChHa, Eq, Fe, GP, Op, Other, Pm, Rb
Applications: WB, Flow
NBP2-13674
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for RIP140 Antibody (NBP2-13674) (0)

There are no publications for RIP140 Antibody (NBP2-13674).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for RIP140 Antibody (NBP2-13674) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Human.
We have 1 review tested in 1 application: WB.

Reviews using NBP2-13674:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot RIP140 NBP2-13674
Enlarge
reviewed by:
Shilpa Agarwal
WB Human 12/09/2014
View

Summary

ApplicationWestern Blot
Sample TestedLysate from HEK293 cells
SpeciesHuman

Blocking

Blocking DetailsNon-fat dry milk (5%) in 1X PBS

Primary Anitbody

Dilution Ratio1:1000 dilution, 3 hrs at RT in 5% non-fat dry milk

Secondary Antibody

Secondary Descriptionanti rabbit HRP-conjugated antibody
Secondary Manufacturer Cat#Life Technologies # 65-6120
Secondary Concentration1:10,000

Details

Detection NotesSuperSignal West Pico Chemiluminescent Substrate (Thermo), 30 sec exposure using X-ray film

Comments

CommentsThe antibody gives two closely placed bands, consistent with many other available antibodies.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for RIP140 Antibody (NBP2-13674) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RIP140 Products

Bioinformatics Tool for RIP140 Antibody (NBP2-13674)

Discover related pathways, diseases and genes to RIP140 Antibody (NBP2-13674). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RIP140 Antibody (NBP2-13674)

Discover more about diseases related to RIP140 Antibody (NBP2-13674).
 

Pathways for RIP140 Antibody (NBP2-13674)

View related products by pathway.

PTMs for RIP140 Antibody (NBP2-13674)

Learn more about PTMs related to RIP140 Antibody (NBP2-13674).
 

Research Areas for RIP140 Antibody (NBP2-13674)

Find related products by research area.

Blogs on RIP140

There are no specific blogs for RIP140, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Shilpa Agarwal
12/09/2014
Application: WB
Species: Human

Bioinformatics

Gene Symbol NRIP1