RIP140 Antibody

Images

 
Immunohistochemistry-Paraffin: RIP140 Antibody [NBP2-13674] - Staining of human Fallopian tube shows moderate nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: RIP140 Antibody [NBP2-13674] - Staining of human duodenum shows moderate nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: RIP140 Antibody [NBP2-13674] - Staining of human cerebellum shows moderate nuclear positivity in cells in granular layer.
Immunohistochemistry-Paraffin: RIP140 Antibody [NBP2-13674] - Staining of human skeletal muscle shows weak nuclear positivity in myocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RIP140 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the amino acids: SSEAHLQQYSREHALKTQNANQAASERLAAMARLQENGQKDVGSYQLPKGMSSHLNGQARTSSSKLMASKSSATVFQNPMGIIPSSPKNAGYKNSLERNNIKQ
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NRIP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. RIP140 antibody validated for WB from a verified customer review.
Control Peptide
RIP140 Protein (NBP2-13674PEP)
Reviewed Applications
Read 1 Review rated 4
using
NBP2-13674 in the following applications:

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RIP140 Antibody

  • 10RIP140Receptor-interacting protein 140
  • FLJ77253
  • nuclear receptor interacting protein 1
  • nuclear receptor-interacting protein 1
  • receptor interacting protein 140

Background

Nuclear receptor interacting protein 1 (NRIP1) is a nuclear protein that specifically interacts with the hormone-dependent activation domain AF2 of nuclear receptors. Also known as RIP140, this protein modulates transcriptional activity of the estrogen receptor.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RIP140 Antibody (NBP2-13674) (0)

There are no publications for RIP140 Antibody (NBP2-13674).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for RIP140 Antibody (NBP2-13674) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP2-13674:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot RIP140 NBP2-13674
Enlarge
4
reviewed by:
Shilpa Agarwal
WB Human 12/09/2014
View

Summary

ApplicationWestern Blot
Sample TestedLysate from HEK293 cells
SpeciesHuman

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RIP140 Antibody (NBP2-13674) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RIP140 Products

Research Areas for RIP140 Antibody (NBP2-13674)

Find related products by research area.

Blogs on RIP140

There are no specific blogs for RIP140, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Shilpa Agarwal
12/09/2014
Application: WB
Species: Human

Bioinformatics

Gene Symbol NRIP1