CUTL2 Antibody (2H8)

Images

 
Western Blot: CUTL2 Antibody (2H8) [H00023316-M03] - Analysis of CUX2 expression in HepG2.
ELISA: CUTL2 Antibody (2H8) [H00023316-M03] - Detection limit for recombinant GST tagged CUX2 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-Fr
Clone
2H8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CUTL2 Antibody (2H8) Summary

Immunogen
CUX2 (NP_056082.1, 121 a.a. ~ 220 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. FDPSGQPRRDLHTSWKRNPELLSPKEQREGTSPAGPTLTEGSRLPGIPGKALLTETLLQRNEAEKQKGLQEVQITLAARLGEAEEKIKVLHSALKATQAE
Specificity
This product is specific for Human CUX2 monoclonal antibody (M03), clone 2H8 [Gene ID: 23316].
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CUX2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Frozen
  • Western Blot
Application Notes
Mouse monoclonal antibody raised against a partial recombinant CUX2.
Publications
Read Publication using H00023316-M03.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CUTL2 Antibody (2H8)

  • CDP2
  • CUTL2
  • cut-like 2 (Drosophila)
  • cut-like homeobox 2
  • homeobox protein cut-like 2
  • Homeobox protein cux-2
  • KIAA0293

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00001523-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
H00008805-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, PLA, WB
AF1584
Species: Hu, Mu
Applications: CyTOF-ready, ICC, IP, ICFlow, KO, Simple Western, WB
NBP1-87857
Species: Hu
Applications: IHC, IHC-P, WB
AF2156
Species: Hu, Mu
Applications: ICC, IHC, WB
NBP3-10480
Species: Hu
Applications: IHC, WB
AF1056
Species: Rt
Applications: IHC, WB
AF1555
Species: Hu
Applications: WB
1845-SH/CF
Species: Hu
Applications: BA
AF2408
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, KO, Simple Western, WB
AF2746
Species: Hu, Mu
Applications: ICC, WB
NBP2-84403
Species: Hu
Applications: WB
MAB7557
Species: Hu
Applications: IHC, WB
NBP1-90217
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-28728
Species: Hu
Applications: IHC, IHC-P, IP (-), WB
AF2168
Species: Hu, Mu
Applications: ChIP, Simple Western, WB

Publications for CUTL2 Antibody (H00023316-M03)(1)

Reviews for CUTL2 Antibody (H00023316-M03) (0)

There are no reviews for CUTL2 Antibody (H00023316-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CUTL2 Antibody (H00023316-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CUTL2 Products

Array H00023316-M03

Bioinformatics Tool for CUTL2 Antibody (H00023316-M03)

Discover related pathways, diseases and genes to CUTL2 Antibody (H00023316-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CUTL2 Antibody (H00023316-M03)

Discover more about diseases related to CUTL2 Antibody (H00023316-M03).
 

Pathways for CUTL2 Antibody (H00023316-M03)

View related products by pathway.

PTMs for CUTL2 Antibody (H00023316-M03)

Learn more about PTMs related to CUTL2 Antibody (H00023316-M03).

Blogs on CUTL2

There are no specific blogs for CUTL2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CUTL2 Antibody (2H8) and receive a gift card or discount.

Bioinformatics

Gene Symbol CUX2
Uniprot