Opsin 1 (Long Wave) Antibody


Western Blot: Opsin 1 (Long Wave) Antibody [NBP3-09392] - Western blot analysis of Opsin 1 (Long Wave) in Fetal Heart lysates. Antibody dilution at 1.0ug/ml

Product Details

Reactivity Hu, MuSpecies Glossary
Applications WB

Order Details

Opsin 1 (Long Wave) Antibody Summary

The immunogen is a synthetic peptide directed towards the C-terminal region of human OPN1MW. Peptide sequence SIIVLCYLQVWLAIRAVAKQQKESESTQKAEKEVTRMVVVMVLAFCFCWG
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1.0 ug/ml
Theoretical MW
40 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS buffer, 2% sucrose.
0.09% Sodium Azide
Affinity purified

Alternate Names for Opsin 1 (Long Wave) Antibody

  • CBBM
  • COD5
  • cone dystrophy 5 (X-linked)
  • long-wave-sensitive opsin 1
  • opsin 1 (cone pigments), long-wave-sensitive
  • RCPcolor blindness, protan
  • Red cone photoreceptor pigmentCBP
  • Red-sensitive opsin
  • ROP


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Md, Pm, Rt
Applications: ChIP, EM, Flow-IC, Flow, ICC/IF, IP, In vitro, WB
Species: Hu
Applications: ChIP, IP, WB
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Hu
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: IP, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: EnzAct
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
Species: Pm, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu
Applications: Simple Western, WB
Species: Hu, Mu
Applications: WB

Publications for Opsin 1 (Long Wave) Antibody (NBP3-09392) (0)

There are no publications for Opsin 1 (Long Wave) Antibody (NBP3-09392).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Opsin 1 (Long Wave) Antibody (NBP3-09392) (0)

There are no reviews for Opsin 1 (Long Wave) Antibody (NBP3-09392). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Opsin 1 (Long Wave) Antibody (NBP3-09392) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Opsin 1 (Long Wave) Products

Array NBP3-09392

Bioinformatics Tool for Opsin 1 (Long Wave) Antibody (NBP3-09392)

Discover related pathways, diseases and genes to Opsin 1 (Long Wave) Antibody (NBP3-09392). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Opsin 1 (Long Wave) Antibody (NBP3-09392)

Discover more about diseases related to Opsin 1 (Long Wave) Antibody (NBP3-09392).

Pathways for Opsin 1 (Long Wave) Antibody (NBP3-09392)

View related products by pathway.

PTMs for Opsin 1 (Long Wave) Antibody (NBP3-09392)

Learn more about PTMs related to Opsin 1 (Long Wave) Antibody (NBP3-09392).

Research Areas for Opsin 1 (Long Wave) Antibody (NBP3-09392)

Find related products by research area.

Blogs on Opsin 1 (Long Wave)

There are no specific blogs for Opsin 1 (Long Wave), but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Opsin 1 (Long Wave) Antibody and receive a gift card or discount.


Gene Symbol OPN1LW