TGF-alpha Antibody


Western Blot: TGF alpha Antibody [NBP1-87501] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed more
Immunohistochemistry-Paraffin: TGF alpha Antibody [NBP1-87501] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

TGF-alpha Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: LENSTSPLSDPPVAAAVVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQ
Specificity of human TGF-alpha antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Positive Control
TGF-alpha Lysate (NBP2-66097)
Control Peptide
TGF-alpha Protein (NBP1-87501PEP)
Read Publication using
NBP1-87501 in the following applications:

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for TGF-alpha Antibody

  • protransforming growth factor alpha
  • TFGA
  • TGFA
  • TGFalpha
  • TGF-alpha
  • transforming growth factor, alpha
  • transforming growth factor-alpha


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
Species: Hu, Mu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE

Publications for TGF-alpha Antibody (NBP1-87501)(1)

Reviews for TGF-alpha Antibody (NBP1-87501) (0)

There are no reviews for TGF-alpha Antibody (NBP1-87501). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TGF-alpha Antibody (NBP1-87501) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional TGF-alpha Products

Bioinformatics Tool for TGF-alpha Antibody (NBP1-87501)

Discover related pathways, diseases and genes to TGF-alpha Antibody (NBP1-87501). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TGF-alpha Antibody (NBP1-87501)

Discover more about diseases related to TGF-alpha Antibody (NBP1-87501).

Pathways for TGF-alpha Antibody (NBP1-87501)

View related products by pathway.

PTMs for TGF-alpha Antibody (NBP1-87501)

Learn more about PTMs related to TGF-alpha Antibody (NBP1-87501).

Research Areas for TGF-alpha Antibody (NBP1-87501)

Find related products by research area.

Blogs on TGF-alpha

There are no specific blogs for TGF-alpha, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TGF-alpha Antibody and receive a gift card or discount.


Gene Symbol TGFA