| Immunogen | This Survivin Antibody was developed against a recombinant protein corresponding to amino acids: MGAPTLPPAWQPFLKDHRISTFKNWPFLEGCACTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDDPIEEHKKHSSGCAFLSVKKQFEELTLGEFLKLDRERAKNKIAKETNNKKKEFEETA |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | BIRC5 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Theoretical MW | 16 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
| Publication using NBP2-48494 | Applications | Species |
|---|---|---|
| Lin M, Fang Z, Lin X et al. TRIM55 inhibits colorectal cancer development via enhancing protein degradation of c-Myc Cancer medicine 2023-05-22 [PMID: 37212463] |
Secondary Antibodies |
Isotype Controls |
Research Areas for Survivin Antibody (NBP2-48494)Find related products by research area.
|
|
Read full blog post. |
|
The Ins and Outs of Survivin By Rachel M.A. Linger, Ph.D.What is survivin?Survivin is a small (16.5 kDa) protein normally found in human fetal tissue. In contrast, survivin is typically undetectable in most normal adult tissues. Expression of ... Read full blog post. |
|
Survivin - an inhibitor of apoptosis that drives tumorigenesis and metastasis Apoptosis is the tightly regulated process of programmed cell death. It plays an important role in normal physiologic development but has also been implicated in a number of diseases. Apoptosis is constantly downregulated by a family of anti-apop... Read full blog post. |
|
Survivin - an inhibitor of apoptosis protein Survivin is an anti-apoptotic protein which is the smallest protein within a large family of proteins including X-linked IAP, c-IAP1 and 2, IAP-like protein-2, melanoma IAP, NAIP, and Livin. Survivin is responsible for a wide range of basic cellula... Read full blog post. |
|
Cytochrome C - a mediator of apoptosis Cytochrome C is a small heme protein within the inner mitochondrial membrane responsible for carrying electrons within the respiratory transport chain. Additionally, cytochrome c has also been identified as a player in programmed cell death (apop... Read full blog post. |
|
PCNA (Proliferating cell nuclear antigen, polymerase delta auxiliary protein) PCNA is a nuclear protein essential for DNA replication as well as DNA excision and mismatch repair pathways. It coordinates the recruitment and association of needed components during both of these processes, both of which are essential for cell cycl... Read full blog post. |
|
Survivin is thrivin' The survivin anti-apoptotic protein is the smallest member of a large family of proteins such as X-linked IAP, c-IAP1 and 2, IAP-like protein-2, melanoma IAP, Livin, and NAIP. Survivin regulates basic physiological events such as the cell cycle, tumor... Read full blog post. |
|
Livin: On a Prayer Livin is a member of the inhibitor of apoptosis proteins (IAP) family that regulates programmed cell death. The Livin protein contains a single baculovirus IAP repeat (BIR) essential for function, along with a COOH-terminal RING-type zinc finger domai... Read full blog post. |
|
Survivin: As long as I know how to live I know I will Survivin is an anti-apoptotic protein from a large family with related members such as X-linked IAP, cIAP1 and cIAP2, IAP-like protein-2, melanoma IAP, Livin, and NAIP. Survivin regulates fundamental physiological events including the cell cycle, feta... Read full blog post. |
|
Survivin: Infographic Survivin is involved in promoting cell proliferation and is an inhibitor of apoptosis. Survivin has a critical role in cancer proliferation and neural development. It may have an impact on neural cell proliferative responses following brain injury.L... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | BIRC5 |