Amylin Antibody

Immunohistochemistry-Paraffin: Amylin Antibody [NBP2-33680] - Staining of human placenta shows no positivity in trophoblastic cells as expected.

Immunohistochemistry: Amylin Antibody [NBP2-33680] - Staining of human pancreas shows distinct cytoplasmic positivity in islets of Langerhans.

Immunohistochemistry-Paraffin: Amylin Antibody [NBP2-33680] - Staining of human skeletal muscle shows no cytoplasmic positivity in myocytes as expected.

Immunohistochemistry-Paraffin: Amylin Antibody [NBP2-33680] - Staining in human pancreas and skeletal muscle tissues . Corresponding IAPP RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Amylin Antibody [NBP2-33680] - Analysis in human pancreas and skeletal muscle tissues. Corresponding Amylin RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Amylin Antibody [NBP2-33680] - Staining of human kidney shows no positivity in cells in tubules and cells in glomeruli as expected.

Immunohistochemistry-Paraffin: Amylin Antibody [NBP2-33680] - Staining of human pancreas shows moderate cytoplasmic positivity in islets of Langerhans.

• Reactivity: Hu
• Applications: IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

Amylin Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LVHSSNNFGAILSSTNVGSNTYGKRNAVEVLKREPLNYLP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: IAPP
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Amylin Recombinant Protein Antigen (NBP2-33680PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Amylin Antibody

• AMYLIN
• DAPamylin
• Diabetes-associated peptide
• IAP
• Insulinoma amyloid peptide
• Islet amyloid polypeptide (diabetes-associated peptide; amylin)
• islet amyloid polypeptide

Background

Amylin is commonly found in pancreatic islets of patients suffering diabetes mellitus type II, or harboring an insulinoma. While the association of amylin with the development of type II diabetes has been known for some time, a direct causative role for amylin has been harder to establish. Recent results suggest that amylin, like the related beta amyloid (Abeta) associated with Alzheimer's disease, can induce apoptotic cell death in particular cultured cells, an effect that may be relevant to the development of type II diabetes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: IAPP
• Uniprot:
  • P10997(Human)