Amylin Antibody

Images

 
Immunohistochemistry-Paraffin: Amylin Antibody [NBP2-33680] - Staining of human placenta shows no positivity in trophoblastic cells as expected.
Immunohistochemistry: Amylin Antibody [NBP2-33680] - Staining of human pancreas shows distinct cytoplasmic positivity in islets of Langerhans.
Immunohistochemistry-Paraffin: Amylin Antibody [NBP2-33680] - Staining of human skeletal muscle shows no cytoplasmic positivity in myocytes as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Amylin Antibody [NBP2-33680] - Staining in human pancreas and skeletal muscle tissues . Corresponding IAPP RNA-seq data are presented for the same tissues.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Amylin Antibody [NBP2-33680] - Analysis in human pancreas and skeletal muscle tissues. Corresponding Amylin RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Amylin Antibody [NBP2-33680] - Staining of human kidney shows no positivity in cells in tubules and cells in glomeruli as expected.
Immunohistochemistry-Paraffin: Amylin Antibody [NBP2-33680] - Staining of human pancreas shows moderate cytoplasmic positivity in islets of Langerhans.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Amylin Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LVHSSNNFGAILSSTNVGSNTYGKRNAVEVLKREPLNYLP
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IAPP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Amylin Recombinant Protein Antigen (NBP2-33680PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Amylin Antibody

  • AMYLIN
  • DAPamylin
  • Diabetes-associated peptide
  • IAP
  • Insulinoma amyloid peptide
  • Islet amyloid polypeptide (diabetes-associated peptide; amylin)
  • islet amyloid polypeptide

Background

Amylin is commonly found in pancreatic islets of patients suffering diabetes mellitus type II, or harboring an insulinoma. While the association of amylin with the development of type II diabetes has been known for some time, a direct causative role for amylin has been harder to establish. Recent results suggest that amylin, like the related beta amyloid (Abeta) associated with Alzheimer's disease, can induce apoptotic cell death in particular cultured cells, an effect that may be relevant to the development of type II diabetes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Amylin Antibody (NBP2-33680) (0)

There are no publications for Amylin Antibody (NBP2-33680).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Amylin Antibody (NBP2-33680) (0)

There are no reviews for Amylin Antibody (NBP2-33680). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Amylin Antibody (NBP2-33680) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Amylin Products

Research Areas for Amylin Antibody (NBP2-33680)

Find related products by research area.

Blogs on Amylin

There are no specific blogs for Amylin, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Amylin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IAPP
Uniprot