SOD1/Cu-Zn SOD Antibody

Images

 
Western Blot: SOD1/Cu-Zn SOD Antibody [NBP1-90186] - Western blot analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.
Immunocytochemistry/ Immunofluorescence: SOD1/Cu-Zn SOD Antibody [NBP1-90186] - Staining of human cell line U-251 MG shows positivity in nucleus but not nucleoli and cytoplasm.
Immunohistochemistry-Paraffin: SOD1/Cu-Zn SOD Antibody [NBP1-90186] - Immunohistochemical staining of human fallopian tube shows moderate nuclear positivity in glandular cells.
Western Blot: SOD1/Cu-Zn SOD Antibody [NBP1-90186] - Analysis in human cell line HepG2.
Immunohistochemistry-Paraffin: SOD1/Cu-Zn SOD Antibody [NBP1-90186] - Immunohistochemical staining of human kidney shows moderate cytoplasmic and nuclear positivity in cells in tubules.
Immunohistochemistry-Paraffin: SOD1/Cu-Zn SOD Antibody [NBP1-90186] - Immunohistochemical staining of human liver shows strong nuclear and cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: SOD1/Cu-Zn SOD Antibody [NBP1-90186] - Immunohistochemical staining of human testis shows moderate nuclear and cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.
Simple Western: SOD1/Cu-Zn SOD Antibody [NBP1-90186] - Simple Western lane view shows a specific band for SOD1 in 0.2 mg/ml of RT-4 (left) and U-251MG sp (right) lysate. This experiment was performed under reducing ...read more
Simple Western: SOD1/Cu-Zn SOD Antibody [NBP1-90186] - Electropherogram image(s) of corresponding Simple Western lane view. SOD1/Cu-Zn SOD antibody was used at 1:30 dilution on RT-4 and U-251MG sp lysates(s).

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, Simple Western, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SOD1/Cu-Zn SOD Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHCIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SOD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Simple Western 1:30
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:1000-1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.
Control Peptide
SOD1/Cu-Zn SOD Protein (NBP1-90186PEP)
Publications
Read Publications using
NBP1-90186 in the following applications:

  • IHC
    1 publication
  • WB
    2 publications

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25313982).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SOD1/Cu-Zn SOD Antibody

  • ALS
  • ALS1
  • amyotrophic lateral sclerosis 1 (adult)
  • Cu
  • Cu/Zn superoxide dismutase
  • CuZn SOD
  • Cu-Zn SOD
  • EC 1.15.1.1
  • homodimer
  • hSod1
  • indophenoloxidase A
  • Ipo1
  • IPOA
  • SOD
  • SOD, cytosolic
  • SOD, Soluble
  • SOD1
  • superoxide dismutase [Cu-Zn]
  • Superoxide dismutase 1
  • superoxide dismutase 1, soluble
  • Zn superoxide dismutase, EC 1.15.1.110superoxide dismutase, cystolic

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB600-935
Species: Bv
Applications: WB, ELISA, IP
NB100-1992
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Dr, Gt, GP, Ha, Mk, Rb, Sh, Sq, Xp
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-61572
Species: Hu, Bv, Pm
Applications: WB
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF3667
Species: Hu, Mu
Applications: WB, Simple Western, IHC, ICC
NB100-858
Species: Hu, Mu, Rt, GP, Mk
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IHC-WhMt
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-90186
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P

Publications for SOD1/Cu-Zn SOD Antibody (NBP1-90186)(2)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 2 applications: IHC, WB.


Filter By Application
IHC
(1)
WB
(2)
All Applications
Filter By Species
Human
(1)
Mouse
(1)
All Species

Reviews for SOD1/Cu-Zn SOD Antibody (NBP1-90186) (0)

There are no reviews for SOD1/Cu-Zn SOD Antibody (NBP1-90186). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SOD1/Cu-Zn SOD Antibody (NBP1-90186) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SOD1/Cu-Zn SOD Products

Bioinformatics Tool for SOD1/Cu-Zn SOD Antibody (NBP1-90186)

Discover related pathways, diseases and genes to SOD1/Cu-Zn SOD Antibody (NBP1-90186). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SOD1/Cu-Zn SOD Antibody (NBP1-90186)

Discover more about diseases related to SOD1/Cu-Zn SOD Antibody (NBP1-90186).
 

Pathways for SOD1/Cu-Zn SOD Antibody (NBP1-90186)

View related products by pathway.

PTMs for SOD1/Cu-Zn SOD Antibody (NBP1-90186)

Learn more about PTMs related to SOD1/Cu-Zn SOD Antibody (NBP1-90186).
 

Research Areas for SOD1/Cu-Zn SOD Antibody (NBP1-90186)

Find related products by research area.

Blogs on SOD1/Cu-Zn SOD

There are no specific blogs for SOD1/Cu-Zn SOD, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SOD1/Cu-Zn SOD Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SOD1
Entrez