SOD1/Cu-Zn SOD Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: SOD1/Cu-Zn SOD Antibody [NBP1-90186] - Staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.

Analysis in human liver and pancreas tissues using NBP1-90186 antibody. Corresponding SOD1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: SOD1/Cu-Zn SOD Antibody [NBP1-90186] - staining of human liver shows strong nuclear and cytoplasmic positivity in hepatocytes.

Immunohistochemistry-Paraffin: SOD1/Cu-Zn SOD Antibody [NBP1-90186] - Staining of human pancreas shows very weak nuclear positivity in exocrine glandular cells.

Immunohistochemistry-Paraffin: SOD1/Cu-Zn SOD Antibody [NBP1-90186] - Staining of human testis shows moderate nuclear and cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.

Immunohistochemistry-Paraffin: SOD1/Cu-Zn SOD Antibody [NBP1-90186] - Staining of human fallopian tube shows moderate nuclear positivity in glandular cells.

Simple Western: SOD1/Cu-Zn SOD Antibody [NBP1-90186] - Simple Western lane view shows a specific band for SOD1 in 0.2 mg/ml of RT-4 (left) and U-251MG sp (right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.

Simple Western: SOD1/Cu-Zn SOD Antibody [NBP1-90186] - Electropherogram image(s) of corresponding Simple Western lane view. SOD1/Cu-Zn SOD antibody was used at 1:30 dilution on RT-4 and U-251MG sp lysates(s).

Western Blot: SOD1/Cu-Zn SOD Antibody [NBP1-90186] - Analysis in Hep-G2 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-SOD1 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.

Analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.

• Reactivity: Hu, Mu, Rt
• Applications: WB, Simple Western, ICC/IF, IHC, Mycoplasma
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SOD1/Cu-Zn SOD Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SOD1/Cu-Zn SOD Antibody - BSA Free (NBP1-90186) is a polyclonal antibody validated for use in IHC, WB, ICC/IF and Simple Western. Anti-SOD1/Cu-Zn SOD Antibody: Cited in 3 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHCIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SOD1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Knockdown Validated
  • Simple Western 1:30
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF PFA/Triton X-100.. In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
  See Simple Western Antibody Database for Simple Western validation: Tested in RT-4 and U-251MG, separated by Size, antibody dilution of 1:30, apparent MW was 25 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue.
• Control Peptide:

  SOD1/Cu-Zn SOD Protein (NBP1-90186PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SOD1/Cu-Zn SOD Antibody - BSA Free

• ALS
• ALS1
• amyotrophic lateral sclerosis 1 (adult)
• Cu
• Cu/Zn superoxide dismutase
• CuZn SOD
• Cu-Zn SOD
• EC 1.15.1.1
• homodimer
• hSod1
• indophenoloxidase A
• Ipo1
• IPOA
• SOD
• SOD, cytosolic
• SOD, Soluble
• SOD1
• superoxide dismutase [Cu-Zn]
• Superoxide dismutase 1
• superoxide dismutase 1, soluble
• Zn superoxide dismutase, EC 1.15.1.110superoxide dismutase, cystolic

Background

FUNCTION: Destroys radicals which are normally produced within the cells and which are toxic to biological systems. CATALYTIC ACTIVITY: 2 superoxide + 2 H+ = O2 + H2O2. COFACTOR: Binds 1 copper ion per subunit. COFACTOR: Binds 1 zinc ion per subunit. SUBUNIT: Homodimer. SUBCELLULAR LOCATION: Cytoplasm. DISEASE: Defects in SOD1 are the cause of familial amyotrophic lateral sclerosis (FALS); also called amyotrophic lateral sclerosis 1 (ALS1 or ALS). ALS is a degenerative disorder of motorneurons in the cortex, brainstem and spinal cord. ALS is characterized by muscular weakness and atrophy beginning in the hands and spreading to the forearms and legs. Muscle fasciculations are commonly visible. Sensory abnormalities are absent. Death usually occurs within 2 to 5 years. ALS is sometimes referred to as Lou Gehrig disease after the famous American baseball player who was diagnosed with the disorder. FALS, the familial form of ALS, accounts for about 10% of the cases and is transmitted in an autosomal dominant manner. The mean age at onset of FALS is 45 years. MISCELLANEOUS: Zinc binding promotes dimerization. SIMILARITY: Belongs to the Cu-Zn superoxide dismutase family.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SOD1/Cu-Zn SOD Antibody (NBP1-90186)(3)

Publications using NBP1-90186

• Rutkowska A, Eberl HC, Werner T, Hennrich ML et Al. Synergistic Effects of PARP Inhibition and Cholesterol Biosynthesis Pathway Modulation Cancer Res Commun 2024-07-19 [PMID: 39028932]
• Audrey Filezac de L'Etang, Niran Maharjan, Marisa Cordeiro Brana et al. Marinesco-Sjogren syndrome protein SIL1 regulates motor neuron subtype-selective ER stress in ALS. Nature Neuroscience 2015-01-05 [PMID: 25559081] (WB, IF/IHC, Mouse)
• Miettinen TP, Bjorklund M. NQO2 Is a Reactive Oxygen Species Generating Off-Target for Acetaminophen. Mol Pharm 2014-12-01 [PMID: 25313982] (WB, Human)

Bioinformatics

• Gene Symbol: SOD1