GLYAT Antibody


Western Blot: GLYAT Antibody [NBP2-58917] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma and human liver tissue.
Immunohistochemistry-Paraffin: GLYAT Antibody [NBP2-58917] - Staining of human skeletal muscle.
Immunohistochemistry-Paraffin: GLYAT Antibody [NBP2-58917] - Staining of human duodenum shows low expression as expected.
Immunohistochemistry-Paraffin: GLYAT Antibody [NBP2-58917] - Staining of human kidney shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: GLYAT Antibody [NBP2-58917] - Staining in human kidney and duodenum tissues using anti-GLYAT antibody. Corresponding GLYAT RNA-seq data are presented for the more
Independent Antibodies: Immunohistochemistry-Paraffin: GLYAT Antibody [NBP2-58917] - Staining of human colon, kidney, liver and skeletal muscle using Anti-GLYAT antibody NBP2-58917 (A) shows similar protein more
Immunohistochemistry-Paraffin: GLYAT Antibody [NBP2-58917] - Staining of human colon.
Immunohistochemistry-Paraffin: GLYAT Antibody [NBP2-58917] - Staining of human liver.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

GLYAT Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: YTNTYQIYSKDPQNCQEFLGSPELINWKQHLQIQSSQPSLNEAIQNLAAIKSFKVKQTQRILYMAAETAKELT
Specificity of human GLYAT antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GLYAT Recombinant Protein Antigen (NBP2-58917PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for GLYAT Antibody

  • Acyl-CoA:glycine N-acyltransferase
  • Aralkyl acyl-CoA N-acyltransferase
  • Aralkyl acyl-CoA:amino acid N-acyltransferase
  • aralkyl-CoA N-acyltransferase
  • glycine N-acyltransferase
  • glycine-N-acyltransferase


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt, Gp, Rb, Sh, Ye
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, B/N
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, KO
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC
Species: Hu, Mu, Bv, Gt, Sh
Applications: WB
Species: Hu, Mu, Rt, Ch, Gp, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl, IHC-WhMt
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Ze
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P

Publications for GLYAT Antibody (NBP2-58917) (0)

There are no publications for GLYAT Antibody (NBP2-58917).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GLYAT Antibody (NBP2-58917) (0)

There are no reviews for GLYAT Antibody (NBP2-58917). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GLYAT Antibody (NBP2-58917) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional GLYAT Products

Bioinformatics Tool for GLYAT Antibody (NBP2-58917)

Discover related pathways, diseases and genes to GLYAT Antibody (NBP2-58917). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GLYAT Antibody (NBP2-58917)

Discover more about diseases related to GLYAT Antibody (NBP2-58917).

Pathways for GLYAT Antibody (NBP2-58917)

View related products by pathway.

PTMs for GLYAT Antibody (NBP2-58917)

Learn more about PTMs related to GLYAT Antibody (NBP2-58917).

Blogs on GLYAT

There are no specific blogs for GLYAT, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our GLYAT Antibody and receive a gift card or discount.


Gene Symbol GLYAT