GLYAT Antibody

Images

 
Western Blot: GLYAT Antibody [NBP2-58917] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma and human liver tissue.
Immunohistochemistry-Paraffin: GLYAT Antibody [NBP2-58917] - Staining of human skeletal muscle.
Immunohistochemistry-Paraffin: GLYAT Antibody [NBP2-58917] - Staining of human duodenum shows low expression as expected.
Immunohistochemistry-Paraffin: GLYAT Antibody [NBP2-58917] - Staining of human kidney shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: GLYAT Antibody [NBP2-58917] - Staining in human kidney and duodenum tissues using anti-GLYAT antibody. Corresponding GLYAT RNA-seq data are presented for the ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: GLYAT Antibody [NBP2-58917] - Staining of human colon, kidney, liver and skeletal muscle using Anti-GLYAT antibody NBP2-58917 (A) shows similar protein ...read more
Immunohistochemistry-Paraffin: GLYAT Antibody [NBP2-58917] - Staining of human colon.
Immunohistochemistry-Paraffin: GLYAT Antibody [NBP2-58917] - Staining of human liver.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GLYAT Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: YTNTYQIYSKDPQNCQEFLGSPELINWKQHLQIQSSQPSLNEAIQNLAAIKSFKVKQTQRILYMAAETAKELT
Specificity
Specificity of human GLYAT antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GLYAT
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GLYAT Recombinant Protein Antigen (NBP2-58917PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for GLYAT Antibody

  • ACGNATAAc
  • Acyl-CoA:glycine N-acyltransferase
  • Aralkyl acyl-CoA N-acyltransferase
  • Aralkyl acyl-CoA:amino acid N-acyltransferase
  • aralkyl-CoA N-acyltransferase
  • CATEC 2.3.1.13
  • GATHRP-1(CLP)
  • glycine N-acyltransferase
  • glycine-N-acyltransferase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-80461
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NB300-731
Species: Hu, Mu, Rt, Gp, Rb, Sh, Ye
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, B/N
NBP1-31329
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, KO
NB300-187
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC
NB110-61574
Species: Hu, Mu, Bv, Gt, Sh
Applications: WB
NBP1-30052
Species: Hu, Mu, Rt, Ch, Gp, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl, IHC-WhMt
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB600-41532
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-67656
Species: Hu, Mu, Rt, Ze
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-69571
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-58917
Species: Hu
Applications: WB, IHC, IHC-P

Publications for GLYAT Antibody (NBP2-58917) (0)

There are no publications for GLYAT Antibody (NBP2-58917).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GLYAT Antibody (NBP2-58917) (0)

There are no reviews for GLYAT Antibody (NBP2-58917). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GLYAT Antibody (NBP2-58917) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional GLYAT Products

Bioinformatics Tool for GLYAT Antibody (NBP2-58917)

Discover related pathways, diseases and genes to GLYAT Antibody (NBP2-58917). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GLYAT Antibody (NBP2-58917)

Discover more about diseases related to GLYAT Antibody (NBP2-58917).
 

Pathways for GLYAT Antibody (NBP2-58917)

View related products by pathway.

PTMs for GLYAT Antibody (NBP2-58917)

Learn more about PTMs related to GLYAT Antibody (NBP2-58917).

Blogs on GLYAT

There are no specific blogs for GLYAT, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GLYAT Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GLYAT