Xanthine Oxidase Antibody (0M8E7)

Images

 
Western Blot: Xanthine Oxidase Antibody (0M8E7) [NBP3-16735] - Western blot analysis of extracts of various cell lines, using Xanthine Oxidase (XDH) Rabbit mAb (NBP3-16735) at 1:1000 dilution. Secondary antibody: HRP ...read more
Immunocytochemistry/ Immunofluorescence: Xanthine Oxidase Antibody (0M8E7) [NBP3-16735] - Immunofluorescence analysis of NIH-3T3 cells using Xanthine Oxidase (XDH) Rabbit mAb (NBP3-16735) at dilution of 1:100 (40x ...read more
Immunohistochemistry-Paraffin: Xanthine Oxidase Antibody (0M8E7) [NBP3-16735] - Mouse brain using Xanthine Oxidase (XDH) Rabbit mAb (NBP3-16735) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with ...read more
Immunohistochemistry-Paraffin: Xanthine Oxidase Antibody (0M8E7) [NBP3-16735] - Rat kidney using Xanthine Oxidase (XDH) Rabbit mAb (NBP3-16735) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 ...read more
Immunohistochemistry-Paraffin: Xanthine Oxidase Antibody (0M8E7) [NBP3-16735] - Human oophoroma using Xanthine Oxidase (XDH) Rabbit mAb (NBP3-16735) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC
Clone
0M8E7
Clonality
Monoclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Xanthine Oxidase Antibody (0M8E7) Summary

Additional Information
Recombinant Monoclonal Antibody
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 202-293 of human Xanthine Oxidase (XDH) (P47989). TPLDPTQEPIFPPELLRLKDTPRKQLRFEGERVTWIQASTLKELLDLKAQHPDAKLVVGNTEIGIEMKFKNMLFPMIVCPAWIPELNSVEHG
Isotype
IgG
Clonality
Monoclonal
Host
Rabbit
Gene
XDH
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS, 0.05% BSA, 50% glycerol, pH7.3
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Xanthine Oxidase Antibody (0M8E7)

  • EC 1.17.1.4
  • EC 1.17.3.2
  • EC 1.7.2.2
  • xanthene dehydrogenase
  • xanthine dehydrogenase
  • xanthine dehydrogenase/oxidase
  • Xanthine Oxidase
  • xanthine oxidoreductase
  • XD
  • XDH
  • XDHA
  • XO
  • XOR
  • XOR)

Background

Xanthine dehydrogenase belongs to the group of molybdenum-containing hydroxylases involved in the oxidative metabolism of purines. The enzyme is a homodimer. Xanthine dehydrogenase can be converted to xanthine oxidase by reversible sulfhydryl oxidation or by irreversible proteolytic modification. Defects in xanthine dehydrogenase cause xanthinuria, may contribute to adult respiratory stress syndrome, and may potentiate influenza infection through an oxygen metabolite-dependent mechanism. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP2-24915
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
AF5928
Species: Hu
Applications: ICC, IHC, WB
AF3667
Species: Hu, Mu
Applications: ICC, IHC, Simple Western, WB
NB300-605
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, WB
NBP1-86616
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-58917
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-87404
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, KD, WB
NB100-56503
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-16684
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NB600-41532
Species: Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-39681
Species: Bt, Ca, Eq, Hu, Pm, Mu, Pm, Rb, Rt
Applications: ICC, IHC, IHC-P, IP, WB
NB300-560
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr, IHC-P, WB
NB100-74510
Species: Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
MAB2476
Species: Hu
Applications: IHC, WB
NB100-182
Species: Av, Ca, Hu, Ma, Mu, Pm, Rt, Ze
Applications: ChIP, ChIP, Flow, IB, ICC/IF, IHC, IHC-P, IP, KD, KO, RNAi, Simple Western, WB
NB300-500
Species: Am, Bv, Ca, Dr, Hu, Mu, Po, Rt, Sh
Applications: IHC, IHC-Fr, IHC-P, WB
AF7007
Species: Mu
Applications: IHC, WB
NBP3-16735
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC

Publications for Xanthine Oxidase Antibody (NBP3-16735) (0)

There are no publications for Xanthine Oxidase Antibody (NBP3-16735).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Xanthine Oxidase Antibody (NBP3-16735) (0)

There are no reviews for Xanthine Oxidase Antibody (NBP3-16735). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Xanthine Oxidase Antibody (NBP3-16735) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Xanthine Oxidase Products

Diseases for Xanthine Oxidase Antibody (NBP3-16735)

Discover more about diseases related to Xanthine Oxidase Antibody (NBP3-16735).
 

Pathways for Xanthine Oxidase Antibody (NBP3-16735)

View related products by pathway.

PTMs for Xanthine Oxidase Antibody (NBP3-16735)

Learn more about PTMs related to Xanthine Oxidase Antibody (NBP3-16735).
 

Research Areas for Xanthine Oxidase Antibody (NBP3-16735)

Find related products by research area.

Blogs on Xanthine Oxidase

There are no specific blogs for Xanthine Oxidase, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Xanthine Oxidase Antibody (0M8E7) and receive a gift card or discount.

Bioinformatics

Gene Symbol XDH