ZEB2 Antibody

Western Blot: ZEB2 Antibody [NBP1-82991] - Analysis in human cell lines SK-MEL-30 and Caco-2 using Anti-ZEB2 antibody. Corresponding ZEB2 RNA-seq data are presented for the same cell lines. Loading control: Anti-HDAC1.

Western Blot: ZEB2 Antibody [NBP1-82991] - Depletion of TRIM14 increased ZEB2 polyubiquitination and proteasomal degradation. Western blot analysis of TRIM14, ZEB2 and beta-actin in LN229 and U251 cells transduced with the indicated shRNA in the absence or presence of 10uM MG132. Image collected and cropped by CiteAb from the following publication (//jeccr.biomedcentral.com/articles/10.1186/s13046-019-1070-x), licensed under a CC-BY license.

Immunohistochemistry-Paraffin: ZEB2 Antibody [NBP1-82991] - Staining of human pancreas shows no positivity as expected.

Immunohistochemistry-Paraffin: ZEB2 Antibody [NBP1-82991] - Staining of human cerebral cortex shows moderate nuclear positivity in glial cells.

Immunohistochemistry-Paraffin: ZEB2 Antibody [NBP1-82991] - Staining of human colon shows moderate nuclear positivity in a subset of lymphoid cells.

Immunohistochemistry-Paraffin: ZEB2 Antibody [NBP1-82991] - Staining of human glioma shows moderate nuclear positivity in tumor cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, Flow, ICC/IF, IHC, KD
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

ZEB2 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SPVKPMDSITSPSIAELHNSVTNCDPPLRLTKPSHFTNIKPVEKLDHSRSNTPSPLNLSSTSSKNSHSSSYTPNSFSSEELQAEPLDLSLPKQMKEPKSIIATKNKTKASSISLDHNSVSSSSE
• Predicted Species: Rat (95%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ZEB2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Flow Cytometry
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Knockdown Validated
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: IHC, ICC/IF reported in scientific literature (PMID: 22965162). Flow reported in scientific literature (PMID: 28790065). For IHC-Paraffin, HIER pH 6 retrieval is recommended. Knockdown validation (PMID: 31934283).
• Control Peptide:

  ZEB2 Protein (NBP1-82991PEP)

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 22965162).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ZEB2 Antibody

• HSPC082
• KIAA0569FLJ42816
• SIP1
• SIP1HSPC082
• Smad-interacting protein 1
• SMADIP1
• SMADIP1ZFHX1BSIP-1
• ZEB2
• ZFHX1B
• ZFX1B
• zinc finger E-box binding homeobox 2
• zinc finger E-box-binding homeobox 2
• zinc finger homeobox 1b
• Zinc finger homeobox protein 1b

Background

The ZEB2 gene (also known as SIP1 and SMADIP1) is a member of the delta-EF1 (ZEB1; MIM 189909)/Zfh1 family of 2-handed zinc finger/homeodomain proteins. SMADIP1 interacts with receptor-mediated, activated full-length SMADs (see MIM 605568) (Verschueren et al., 1999 [PubMed 10400677]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ZEB2 Antibody (NBP1-82991)(26)

Publications using NBP1-82991

• Perez-Quintero L, Martinez-Cordoba Z, Carli C et al. Combined inhibition of homologous immunotherapeutic targets PTPN1 and PTPN2 is synergistic in enhancing CD8 T cell effector functions bioRxiv 2023-04-19 (WB)
• Ichikawa MK, Endo K, Itoh Y et al. Ets family proteins regulate the EMT transcription factors Snail and ZEB in cancer cells FEBS open bio 2022-04-22 [PMID: 35451213] (WB, Human)
• Lohraseb I, McCarthy P, Secker G et al. Global ubiquitinome profiling identifies NEDD4 as a regulator of Profilin 1 and actin remodelling in neural crest cells Nature communications 2022-04-19 [PMID: 35440627] (WB)
• Wang J, Farkas C, Benyoucef A et al. Interplay between the EMT transcription factors ZEB1 and ZEB2 regulates hematopoietic stem and progenitor cell differentiation and hematopoietic lineage fidelity PLoS biology 2021-09-22 [PMID: 34550965] (WB, Mouse)
• Moro L, Simoneschi D, Kurz E et al. Epigenetic silencing of the ubiquitin ligase subunit FBXL7 impairs c-SRC degradation and promotes epithelial-to-mesenchymal transition and metastasis Nat. Cell Biol. 2020-08-24 [PMID: 32839549]
• Cai X, Feng S, Zhang J et al. USP18 deubiquitinates and stabilizes Twist1 to promote epithelial-mesenchymal transition in glioblastoma cells Am J Cancer Res 2020-04-01 [PMID: 32368392] (WB, Human)
• Xu R, Zhou F, Yu T et al. MicroRNA-940 inhibits epithelial-mesenchymal transition of glioma cells via targeting ZEB2 Am J Transl Res 2019-12-15 [PMID: 31934283] (WB, KD, Human)
• Osada A H, Endo K et al. Addiction of mesenchymal phenotypes on the FGF/FGFR axis in oral squamous cell carcinoma cells. PLoS One 2019-05-11 [PMID: 31682640] (WB, Human)
• Wang P, Liu X, Han G et al. Downregulated lncRNA UCA1 acts as ceRNA to adsorb microRNA-498 to repress proliferation, invasion and epithelial mesenchymal transition of esophageal cancer cells by decreasing ZEB2 expression Cell Cycle 2019-09-01 [PMID: 31387451] (WB, Human)
• Ordonez, LD;Hay, T;McEwen, R;Polanska, UM;Hughes, A;Delpuech, O;Cadogan, E;Powell, S;Dry, J;Tornillo, G;Silcock, L;Leo, E;O Connor, MJ;Clarke, AR;Smalley, MJ; Rapid activation of epithelial-mesenchymal transition drives PARP inhibitor resistance in Brca2-mutant mammary tumours Oncotarget 2019-04-08 [PMID: 31080552] (WB, Mouse)
• Yang Shanzheng, Toledo Enrique M, Rosmaninho Pedro et al. A Zeb2-miR-200c loop controls midbrain dopaminergic neuron neurogenesis and migration. Communications Biology 2018-06-25 [PMID: 30271956] (IHC-P, Mouse)
• Osada A, Endo K , Kimura Y et al. Addiction of mesenchymal phenotypes on the FGF/FGFR axis in oral squamous cell carcinoma cells BioRxiv (WB, Human)
• Yan Y, He M, Yu Z et al. Combined expression of ZEB2 and ALDH1A1 is correlated with poor prognosis of breast cancer patients Int J Clin Exp Med 2018-03-30 (IF/IHC, Human)
• Park SH, Yoon SJ, Choi S et al. Particulate matter promotes cancer metastasis through increased HBEGF expression in macrophages Experimental & molecular medicine 2022-11-09 [PMID: 36352257] (WB, Human)
• De Angelis ML, Francescangeli F, Nicolazzo C et al. An Orthotopic Patient-Derived Xenograft (PDX) Model Allows the Analysis of Metastasis-Associated Features in Colorectal Cancer Frontiers in Oncology 2022-06-28 [PMID: 35837106] (IHC)
• Feng S, Cai X, Li Y et al. Tripartite motif-containing 14 (TRIM14) promotes epithelial-mesenchymal transition via ZEB2 in glioblastoma cells J. Exp. Clin. Cancer Res. 2019-02-06 [PMID: 30728039] (WB, Human)
• Cichocki F, Valamehr B, Bjordahl R et al. GSk3 Inhibition Drives Maturation of Nk Cells and Enhances Their Antitumor Activity. Cancer Res. 2017-10-15 [PMID: 28790065] (FLOW, Human)
• Krebs AM, Mitschke J, Lasierra Losada M et al. The EMT-activator Zeb1 is a key factor for cell plasticity and promotes metastasis in pancreatic cancer Nature Cell Biology 2017-05-01 [PMID: 28414315]
• Lee E, Wang J, Yumoto K et al. DNMT1 Regulates Epithelial-Mesenchymal Transition and Cancer Stem Cells, Which Promotes Prostate Cancer Metastasis Neoplasia 2016-09-01 [PMID: 27659015] (IF/IHC, Human)
• Hoshi Y, Endo K, Shirakihara T et al. The potential role of regulator of G-protein signaling 16 in cell motility mediated by deltaEF1 family proteins. FEBS Lett. 2016-01-01 [PMID: 26823172] (WB, Human)
• Xiaofeng Zheng, Julienne L. Carstens, Jiha Kim et al. Epithelial-to-mesenchymal transition is dispensable for metastasis but induces chemoresistance in pancreatic cancer. Nature 2015-01-01 [PMID: 26560028] (IHC-P, Mouse)
• Denecker G, Vandamme N, Akay O et al. Identification of a ZEB2-MITF-ZEB1 transcriptional network that controls melanogenesis and melanoma progression. Cell Death Differ 2014-08-01 [PMID: 24769727] (IF/IHC, WB, Human)
• Fang Y, Wei J, Cao J et al. Protein Expression of ZEB2 in Renal Cell Carcinoma and Its Prognostic Significance in Patient Survival. PLoS One 2013-01-01 [PMID: 23658743]
• Piao Y, Liang J, Holmes L et al. Glioblastoma resistance to anti-VEGF therapy is associated with myeloid cell infiltration, stem cell accumulation, and a mesenchymal phenotype Neuro Oncol 2012-09-10 [PMID: 22965162] (ICC/IF, IF/IHC, Human, Mouse)
• Cai MY, Luo RZ, Chen JW et al. Overexpression of ZEB2 in peritumoral liver tissue correlates with favorable survival after curative resection of hepatocellular carcinoma. PLoS One 2012-01-01 [PMID: 22393452]
• Wensman H, Goransson H, Leuchowius KJ et al. Extensive expression of craniofacial related homeobox genes in canine mammary sarcomas. Breast Cancer Res Treat 2009-11-01 [PMID: 19048371]

Reviews for ZEB2 Antibody (NBP1-82991) (2)

Average Rating: 2.5

(Based on 2 reviews)

We have 2 reviews tested in 2 species: Human, Mouse.

reviewed by: Xizi Wu IHC-Fr Mouse 11/08/2019

Summary

• Application: Immunohistochemistry-Frozen
• Sample Tested: Fixed frozen mouse spinal cord
• Species: Mouse
• Lot: B114435

Comments

• Comments: Novus Innovators Program - new species or application used on a primary antibody.

reviewed by: Verified Customer WB Human 11/12/2017

Summary

• Application: Western Blot
• Sample Tested: Cancer Cell lines
• Species: Human
• Lot: B105866

Comments

• Comments: Sample: Whole cell lysates of various cancer cell lines (10ug)
  Blocking: 5% nonfat dry milk reconstituted in TBS-T for 1 hour at room temperature
  Primary Antibody diluted (1:500) in 5% nonfat dry milk reconstituted in TBS-T overnight at 4deg C
  Secondary Antibody: Goat Anti-Rabbit IgG H&L (HRP) (ab97051) at 1/10000 dilution in TBS-T

Bioinformatics

• Gene Symbol: ZEB2