ZEB2 Antibody

Images

 
Orthogonal Strategies: Western Blot: ZEB2 Antibody [NBP1-82991] - Analysis in human cell lines SK-MEL-30 and Caco-2 using Anti-ZEB2 antibody. Corresponding ZEB2 RNA-seq data are presented for the same cell lines. ...read more
Immunohistochemistry-Paraffin: ZEB2 Antibody [NBP1-82991] - Staining of human pancreas shows no positivity as expected.
Immunohistochemistry-Paraffin: ZEB2 Antibody [NBP1-82991] - Staining of human cerebral cortex shows moderate nuclear positivity in glial cells.
Immunohistochemistry-Paraffin: ZEB2 Antibody [NBP1-82991] - Staining of human colon shows moderate nuclear positivity in a subset of lymphoid cells.
Immunohistochemistry-Paraffin: ZEB2 Antibody [NBP1-82991] - Staining of human glioma shows moderate nuclear positivity in tumor cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, Flow, ICC/IF, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

ZEB2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SPVKPMDSITSPSIAELHNSVTNCDPPLRLTKPSHFTNIKPVEKLDHSRSNTPSPLNLSSTSSKNSHSSSYTPNSFSSEELQAEPLDLSLPKQMKEPKSIIATKNKTKASSISLDHNSVSSSSE
Specificity
Specificity of human ZEB2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZEB2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Flow Cytometry
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Knockdown Validated
Application Notes
IHC, ICC/IF reported in scientific literature (PMID: 22965162). Flow reported in the scientific literature (PMID: 28790065). For IHC-Paraffin, HIER pH 6 retrieval is recommended. Knockdown validation (PMID: 31934283).
Control Peptide
ZEB2 Protein (NBP1-82991PEP)
Reviewed Applications
Read 2 Reviews rated 2.5
using
NBP1-82991 in the following applications:

Publications
Read Publications using
NBP1-82991 in the following applications:

  • 1 publication
  • 1 publication
  • IHC
    4 publications
  • 2 publications
  • KD
    1 publication
  • WB
    8 publications

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 22965162).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZEB2 Antibody

  • HSPC082
  • KIAA0569FLJ42816
  • SIP1
  • SIP1HSPC082
  • Smad-interacting protein 1
  • SMADIP1
  • SMADIP1ZFHX1BSIP-1
  • ZEB2
  • ZFHX1B
  • ZFX1B
  • zinc finger E-box binding homeobox 2
  • zinc finger E-box-binding homeobox 2
  • zinc finger homeobox 1b
  • Zinc finger homeobox protein 1b

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-05987
Species: Hu, Mu, Rt
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP, MiAr, ChIP, KD, Single-Cell Western
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-69368
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37578
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP2-03886
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NBP2-45831
Species: Hu
Applications: WB, IHC
NB300-223
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Eq
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-37364
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, Flow-IC, KD
NBP2-27293
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
H00006607-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NB100-1936
Species: Hu, Mu, Rt, Pm, Xp, Ze
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP
NLS54
Species: Hu, Mu, Ca
Applications: WB, ICC/IF, IHC, IHC-P
H00079833-B01P
Species: Hu
Applications: WB, ICC/IF
NBP2-20439
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
MMP200
Species: Hu, Mu, Rt, Po, Ca
NBP1-48309
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC, ICC
NBP1-82991
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, KD

Publications for ZEB2 Antibody (NBP1-82991)(18)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 6 applications: Flow, ICC/IF, IHC, IHC-P, KD, WB.


Filter By Application
Flow
(1)
ICC/IF
(1)
IHC
(4)
IHC-P
(2)
KD
(1)
WB
(8)
All Applications
Filter By Species
Human
(11)
Mouse
(4)
All Species
Showing Publications 1 - 10 of 18. Show All 18 Publications.
Publications using NBP1-82991 Applications Species
Yan Y, He M, Yu Z et al. Combined expression of ZEB2 and ALDH1A1 is correlated with poor prognosis of breast cancer patients Int J Clin Exp Med 2018 Mar 30 (IHC, Human) IHC Human
Osada A, Endo K, Kimura Y et al. Addiction of mesenchymal phenotypes on the FGF/FGFR axis in oral squamous cell carcinoma cells BioRxiv (WB, Human) WB Human
Moro L, Simoneschi D, Kurz E et al. Epigenetic silencing of the ubiquitin ligase subunit FBXL7 impairs c-SRC degradation and promotes epithelial-to-mesenchymal transition and metastasis Nat. Cell Biol. Aug 24 2020 [PMID: 32839549]
Cai X, Feng S, Zhang J et al. USP18 deubiquitinates and stabilizes Twist1 to promote epithelial-mesenchymal transition in glioblastoma cells Am J Cancer Res Apr 1 2020 [PMID: 32368392] (WB, Human) WB Human
Xu R, Zhou F, Yu T et al. MicroRNA-940 inhibits epithelial-mesenchymal transition of glioma cells via targeting ZEB2 Am J Transl Res Dec 15 2019 [PMID: 31934283] (WB, KD, Human) WB, KD Human
Wang P, Liu X, Han G et al. Downregulated lncRNA UCA1 acts as ceRNA to adsorb microRNA-498 to repress proliferation, invasion and epithelial mesenchymal transition of esophageal cancer cells by decreasing ZEB2 expression Cell Cycle Sep 1 2019 [PMID: 31387451] (WB, Human) WB Human
Ordonez, LD;Hay, T;McEwen, R;Polanska, UM;Hughes, A;Delpuech, O;Cadogan, E;Powell, S;Dry, J;Tornillo, G;Silcock, L;Leo, E;O Connor, MJ;Clarke, AR;Smalley, MJ; Rapid activation of epithelial-mesenchymal transition drives PARP inhibitor resistance in Brca2-mutant mammary tumours Oncotarget Apr 8 2019 [PMID: 31080552] (WB, Mouse) WB Mouse
Feng S, Cai X, Li Y et al. Tripartite motif-containing 14 (TRIM14) promotes epithelial-mesenchymal transition via ZEB2 in glioblastoma cells J. Exp. Clin. Cancer Res. Feb 6 2019 [PMID: 30728039] (WB, Human) WB Human
Yang Shanzheng, Toledo Enrique M, Rosmaninho Pedro et al. A Zeb2-miR-200c loop controls midbrain dopaminergic neuron neurogenesis and migration. Communications Biology 2019 Jun 25 [PMID: 30271956] (IHC-P, Mouse) IHC-P Mouse
Cichocki F, Valamehr B, Bjordahl R et al. GSk3 Inhibition Drives Maturation of Nk Cells and Enhances Their Antitumor Activity. Cancer Res. Oct 15 2017 [PMID: 28790065] (Flow, Human) Flow Human
Show All 18 Publications.

Reviews for ZEB2 Antibody (NBP1-82991) (2) 2.52

Average Rating: 2.5
(Based on 2 reviews)
We have 2 reviews tested in 2 species: Human, Mouse.

Reviews using NBP1-82991:
Filter by Applications
IHC-Fr
(1)
WB
(1)
All Applications
Filter by Species
Human
(1)
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry-Frozen ZEB2 NBP1-82991
Enlarge
reviewed by:
Xizi Wu
IHC-Fr Mouse 11/08/2019
View

Summary

ApplicationImmunohistochemistry-Frozen
Sample TestedFixed frozen mouse spinal cord
SpeciesMouse
LotB114435

Comments

CommentsNovus Innovators Program - new species or application used on a primary antibody.
Western Blot ZEB2 NBP1-82991
Enlarge
reviewed by:
Anonymous
WB Human 11/12/2017
View

Summary

ApplicationWestern Blot
Sample TestedCancer Cell lines
SpeciesHuman
LotB105866

Comments

CommentsSample: Whole cell lysates of various cancer cell lines (10ug)
Blocking: 5% nonfat dry milk reconstituted in TBS-T for 1 hour at room temperature
Primary Antibody diluted (1:500) in 5% nonfat dry milk reconstituted in TBS-T overnight at 4deg C
Secondary Antibody: Goat Anti-Rabbit IgG H&L (HRP) (ab97051) at 1/10000 dilution in TBS-T

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ZEB2 Antibody (NBP1-82991) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ZEB2 Products

Array NBP1-82991

Bioinformatics Tool for ZEB2 Antibody (NBP1-82991)

Discover related pathways, diseases and genes to ZEB2 Antibody (NBP1-82991). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZEB2 Antibody (NBP1-82991)

Discover more about diseases related to ZEB2 Antibody (NBP1-82991).
 

Pathways for ZEB2 Antibody (NBP1-82991)

View related products by pathway.

PTMs for ZEB2 Antibody (NBP1-82991)

Learn more about PTMs related to ZEB2 Antibody (NBP1-82991).
 

Research Areas for ZEB2 Antibody (NBP1-82991)

Find related products by research area.

Blogs on ZEB2

There are no specific blogs for ZEB2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

2.5
5
0
4
1
3
0
2
0
1
1

Xizi Wu
11/08/2019
Application: IHC-Fr
Species: Mouse

Anonymous
11/12/2017
Application: WB
Species: Human

Bioinformatics

Gene Symbol ZEB2