ZEB2 Antibody - BSA Free

Images

 
Orthogonal Strategies: Western Blot: ZEB2 Antibody [NBP1-82991] - Analysis in human cell lines SK-MEL-30 and Caco-2 using Anti-ZEB2 antibody. Corresponding ZEB2 RNA-seq data are presented for the same cell lines. ...read more
Western Blot: ZEB2 Antibody [NBP1-82991] - Depletion of TRIM14 increased ZEB2 polyubiquitination and proteasomal degradation. Western blot analysis of TRIM14, ZEB2 and beta-actin in LN229 and U251 cells transduced with ...read more
Immunohistochemistry-Paraffin: ZEB2 Antibody [NBP1-82991] - Staining of human pancreas shows no positivity as expected.
Immunohistochemistry-Paraffin: ZEB2 Antibody [NBP1-82991] - Staining of human cerebral cortex shows moderate nuclear positivity in glial cells.
Immunohistochemistry-Paraffin: ZEB2 Antibody [NBP1-82991] - Staining of human colon shows moderate nuclear positivity in a subset of lymphoid cells.
Immunohistochemistry-Paraffin: ZEB2 Antibody [NBP1-82991] - Staining of human glioma shows moderate nuclear positivity in tumor cells.
SU5402, FGFR1 inhibitor, affects the EMT transcription factors.(A, B) ERK1/2 phosphorylation (p-ERK1/2) was determined by immunoblotting in HSC-4 & OTC-04 treated for 30 min with 30 ng/ml FGF2 or 30 ng/ml FGF7 in ...read more
Western Blot: ZEB2 Antibody [NBP1-82991] - ZEB2 is a downstream target of TRIM14. a Western blot analysis of TRIM14, EMT related biomarks (Snail1, Twist1, ZEB1, ZEB2 & SLUG), & beta -actin in LN229 & U251 cells ...read more
Western Blot: ZEB2 Antibody [NBP1-82991] - TRIM14 function was demonstrated in vivo & IHC. a ShCtrl-transplanted & shTRIM14-transplanted LN229 cells were counted & transplanted in orthotopic nude mice model ...read more
Western Blot: ZEB2 Antibody [NBP1-82991] - ZEB2 is involved in the function of TRIM14. a Western blot analysis of TRIM14, EMT related biomarks (Snail1, Twist1, ZEB1, ZEB2 & SLUG), & beta -actin in HS683 & U87 cells ...read more
ChIP-Exo-Seq composite graph for Anti-ZEB2 (NBP1-82991) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, Flow, ICC/IF, IHC, ChIP, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free
Validated by:
       

Orthogonal Strategies

 

Order Details

View Available Formulations
Catalog# & Formulation Size Price

ZEB2 Antibody - BSA Free Summary

Description
Novus Biologicals Rabbit ZEB2 Antibody - BSA Free (NBP1-82991) is a polyclonal antibody validated for use in IHC, WB, Flow and ICC/IF. Anti-ZEB2 Antibody: Cited in 26 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SPVKPMDSITSPSIAELHNSVTNCDPPLRLTKPSHFTNIKPVEKLDHSRSNTPSPLNLSSTSSKNSHSSSYTPNSFSSEELQAEPLDLSLPKQMKEPKSIIATKNKTKASSISLDHNSVSSSSE
Predicted Species
Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZEB2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Chromatin Immunoprecipitation-exo-Seq 1-10µg per reaction
  • Flow Cytometry Reported in scientific literature (PMID: 28790065)
  • Immunocytochemistry/ Immunofluorescence Reported in scientific literature (PMID: 22965162)
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Knockdown Validated Reported in scientific literature (PMID: 31934283)
  • Western Blot 0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ZEB2 Protein (NBP1-82991PEP)
Reviewed Applications
Read 2 Reviews rated 2.5
using
NBP1-82991 in the following applications:

Publications
Read Publications using
NBP1-82991 in the following applications:

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 22965162).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZEB2 Antibody - BSA Free

  • HSPC082
  • KIAA0569FLJ42816
  • SIP1
  • SIP1HSPC082
  • Smad-interacting protein 1
  • SMADIP1
  • SMADIP1ZFHX1BSIP-1
  • ZEB2
  • ZFHX1B
  • ZFX1B
  • zinc finger E-box binding homeobox 2
  • zinc finger E-box-binding homeobox 2
  • zinc finger homeobox 1b
  • Zinc finger homeobox protein 1b

Background

The ZEB2 gene (also known as SIP1 and SMADIP1) is a member of the delta-EF1 (ZEB1; MIM 189909)/Zfh1 family of 2-handed zinc finger/homeodomain proteins. SMADIP1 interacts with receptor-mediated, activated full-length SMADs (see MIM 605568) (Verschueren et al., 1999 [PubMed 10400677]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-05987
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC,  IHC-P, IP, KD, MiAr, Simple Western, Single-Cell Western, WB
AF748
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, ICC, IHC, Simple Western, WB
NBP1-83976
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NB100-807
Species: Hu
Applications: ICC/IF, PEP-ELISA, WB
NBP2-03886
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NBP2-45831
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NB300-223
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-37364
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC,  IHC-P, KD, WB
AF3639
Species: Hu
Applications: ChIP, ICC, ICFlow, WB
H00006607-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB100-1936
Species: Hu, Mu, Pm, Rt, Xp, Ze
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, IP, WB
NLS54
Species: Ca, Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
H00079833-B01P
Species: Hu
Applications: ICC/IF, WB
NBP2-20439
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
MMP200
Species: Ca, Hu, Mu, Po, Rt
Applications: ELISA
7754-BH/CF
Species: Hu
Applications: BA
NBP1-48309
Species: Hu, Mu, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC,  IHC-P, IP, Simple Western, WB
NBP1-82991
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, ChIP, KD

Publications for ZEB2 Antibody (NBP1-82991)(29)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 7 applications: FLOW, ICC/IF, IF/IHC, IHC-P, KD, WB, Western Blot.


Filter By Application
FLOW
(1)
ICC/IF
(1)
IF/IHC
(4)
IHC-P
(2)
KD
(1)
WB
(12)
Western Blot
(1)
All Applications
Filter By Species
Human
(13)
Mouse
(5)
All Species
Showing Publications 1 - 10 of 29. Show All 29 Publications.
Publications using NBP1-82991 Applications Species
Perez-Quintero L, Martinez-Cordoba Z, Carli C et al. Combined inhibition of homologous immunotherapeutic targets PTPN1 and PTPN2 is synergistic in enhancing CD8 T cell effector functions bioRxiv 2023-04-19 (Western Blot) Western Blot
Kinouchi A, Jubashi T, Tatsuno R et al. Roles of ZEB1 and ZEB2 in E-cadherin expression and cell aggressiveness in head and neck cancer. Genes to cells : devoted to molecular & cellular mechanisms 2024-10-03 [PMID: 39362647]
Osada A, Endo K , Kimura Y et al. Addiction of mesenchymal phenotypes on the FGF/FGFR axis in oral squamous cell carcinoma cells BioRxiv (WB, Human) WB Human
Yan Y, He M, Yu Z et al. Combined expression of ZEB2 and ALDH1A1 is correlated with poor prognosis of breast cancer patients Int J Clin Exp Med 2018-03-30 (IF/IHC, Human) IF/IHC Human
Park SH, Yoon SJ, Choi S et al. Particulate matter promotes cancer metastasis through increased HBEGF expression in macrophages Experimental & molecular medicine 2022-11-09 [PMID: 36352257] (WB, Human) WB Human
Stephen T Higgins, Tyler G Erath, Michael DeSarno, Derek D Reed, Diann E Gaalema, Stacey C Sigmon, Sarah H Heil, Jennifer W Tidey Leveraging the cigarette purchase task to understand relationships between cumulative vulnerabilities, the relative reinforcing effects of smoking, and response to reduced nicotine content cigarettes. Preventive medicine 2022-12-06 [PMID: 35995102]
De Angelis ML, Francescangeli F, Nicolazzo C et al. An Orthotopic Patient-Derived Xenograft (PDX) Model Allows the Analysis of Metastasis-Associated Features in Colorectal Cancer Frontiers in Oncology 2022-06-28 [PMID: 35837106]
Ichikawa MK, Endo K, Itoh Y et al. Ets family proteins regulate the EMT transcription factors Snail and ZEB in cancer cells FEBS open bio 2022-04-22 [PMID: 35451213] (WB, Human) WB Human
Lohraseb I, McCarthy P, Secker G et al. Global ubiquitinome profiling identifies NEDD4 as a regulator of Profilin 1 and actin remodelling in neural crest cells Nature communications 2022-04-19 [PMID: 35440627] (WB) WB
Wang J, Farkas C, Benyoucef A et al. Interplay between the EMT transcription factors ZEB1 and ZEB2 regulates hematopoietic stem and progenitor cell differentiation and hematopoietic lineage fidelity PLoS biology 2021-09-22 [PMID: 34550965] (WB, Mouse) WB Mouse
Show All 29 Publications.

Reviews for ZEB2 Antibody (NBP1-82991) (2) 2.52

Average Rating: 2.5
(Based on 2 reviews)
We have 2 reviews tested in 2 species: Human, Mouse.

Reviews using NBP1-82991:
Filter by Applications
IHC-Fr
(1)
WB
(1)
All Applications
Filter by Species
Human
(1)
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry-Frozen ZEB2 NBP1-82991
Enlarge
1
reviewed by:
Xizi Wu
IHC-Fr Mouse 11/08/2019
View

Summary

ApplicationImmunohistochemistry-Frozen
Sample TestedFixed frozen mouse spinal cord
SpeciesMouse
LotB114435

Comments

Comments***Bio-Techne Response: This review was submitted through the legacy Novus Innovators Program, reflecting a new species or application tested on a primary antibody.***
Western Blot ZEB2 NBP1-82991
Enlarge
4
reviewed by:
Verified Customer
WB Human 11/12/2017
View

Summary

ApplicationWestern Blot
Sample TestedCancer Cell lines
SpeciesHuman
LotB105866

Comments

CommentsSample: Whole cell lysates of various cancer cell lines (10ug)
Blocking: 5% nonfat dry milk reconstituted in TBS-T for 1 hour at room temperature
Primary Antibody diluted (1:500) in 5% nonfat dry milk reconstituted in TBS-T overnight at 4deg C
Secondary Antibody: Goat Anti-Rabbit IgG H&L (HRP) (ab97051) at 1/10000 dilution in TBS-T

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ZEB2 Antibody (NBP1-82991) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZEB2 Products

Research Areas for ZEB2 Antibody (NBP1-82991)

Find related products by research area.

Blogs on ZEB2

There are no specific blogs for ZEB2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

2.5
5
0
4
1
3
0
2
0
1
1

Xizi Wu
11/08/2019
Application: IHC-Fr
Species: Mouse

Verified Customer
11/12/2017
Application: WB
Species: Human

Bioinformatics

Gene Symbol ZEB2