ZEB2 Antibody

Images

 
Western Blot: ZEB2 Antibody [NBP1-82991] - Analysis in human cell line HELA.
Immunohistochemistry-Paraffin: ZEB2 Antibody [NBP1-82991] - Immunohistochemical staining of human cerebral cortex shows moderate nuclear positivity in glial cells.
Immunohistochemistry-Paraffin: ZEB2 Antibody [NBP1-82991] - Immunohistochemical staining of human pancreas shows no positivity as expected.
Immunohistochemistry-Paraffin: ZEB2 Antibody [NBP1-82991] - Immunohistochemical staining of human glioma shows moderate nuclear positivity in tumor cells.
Immunohistochemistry-Paraffin: ZEB2 Antibody [NBP1-82991] - Immunohistochemical staining of human colon shows moderate nuclear positivity in a subset of lymphoid cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZEB2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SPVKPMDSITSPSIAELHNSVTNCDPPLRLTKPSHFTNIKPVEKLDHSRSNTPSPLNLSSTSSKNSHSSSYTPNSFSSEELQAEPLDLSLPKQMKEPKSIIATKNKTKASSISLDHNSVSSSSE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZEB2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ZEB2 Protein (NBP1-82991PEP)
Reviewed Applications
Read 1 Review rated 4
using
NBP1-82991 in the following applications:

Publications
Read Publications using
NBP1-82991 in the following applications:

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23658743), Mouse reactivity reported in scientific literature ( 22965162).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZEB2 Antibody

  • HSPC082
  • KIAA0569FLJ42816
  • SIP1
  • SIP1HSPC082
  • Smad-interacting protein 1
  • SMADIP1
  • SMADIP1ZFHX1BSIP-1
  • ZEB2
  • ZFHX1B
  • ZFX1B
  • zinc finger E-box binding homeobox 2
  • zinc finger E-box-binding homeobox 2
  • zinc finger homeobox 1b
  • Zinc finger homeobox protein 1b

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-05987
Species: Hu, Mu, Rt
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-83976
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-37578
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP2-03886
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NBP1-77177
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, ICC, IF
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-37364
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, ICC
NBP2-27184
Species: Hu, Mu, Ca, Eq
Applications: WB, ICC/IF
H00006607-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB100-1936
Species: Hu, Mu, Rt, Pm, Xp
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
AF4496
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-82075
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-20439
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB200-193
Species: Hu, Mu, Rt, Ch, GP
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-48309
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-82991
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for ZEB2 Antibody (NBP1-82991)(8)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 4 applications: ICC/IF, IHC, IHC-P, WB.


Filter By Application
ICC/IF
(1)
IHC
(3)
IHC-P
(1)
WB
(2)
All Applications
Filter By Species
Human
(4)
Mouse
(2)
All Species
Showing Publications 1 - 8 of 8.
Publications using NBP1-82991 Applications Species
Lee E, Wang J, Yumoto K et al. DNMT1 Regulates Epithelial-Mesenchymal Transition and Cancer Stem Cells, Which Promotes Prostate Cancer Metastasis Neoplasia Sep 1 2016 [PMID: 27659015] (IHC, Human) IHC Human
Hoshi Y, Endo K, Shirakihara T et al. The potential role of regulator of G-protein signaling 16 in cell motility mediated by deltaEF1 family proteins. FEBS Lett. 2016 Jan 01 [PMID: 26823172] (WB, Human) WB Human
Zheng X, Carstens JL, Kim J et al. Epithelial-to-mesenchymal transition is dispensable for metastasis but induces chemoresistance in pancreatic cancer. Nature. 2015 Nov 26 [PMID: 26560028] (IHC-P, Mouse) IHC-P Mouse
Denecker G, Vandamme N, Akay O et al. Identification of a ZEB2-MITF-ZEB1 transcriptional network that controls melanogenesis and melanoma progression. Cell Death Differ 2014 Aug [PMID: 24769727] (IHC, WB, Human) IHC, WB Human
Fang Y, Wei J, Cao J et al. Protein Expression of ZEB2 in Renal Cell Carcinoma and Its Prognostic Significance in Patient Survival. PLoS One 2013 [PMID: 23658743]
Piao Y, Liang J, Holmes L et al. Glioblastoma resistance to anti-VEGF therapy is associated with myeloid cell infiltration, stem cell accumulation, and a mesenchymal phenotype Neuro Oncol 2012 Sep 10 [PMID: 22965162] (IHC, ICC/IF, Human, Mouse) IHC, ICC/IF Human, Mouse
Cai MY, Luo RZ, Chen JW et al. Overexpression of ZEB2 in peritumoral liver tissue correlates with favorable survival after curative resection of hepatocellular carcinoma. PLoS One 2012 [PMID: 22393452]
Wensman H, Goransson H, Leuchowius KJ et al. Extensive expression of craniofacial related homeobox genes in canine mammary sarcomas. Breast Cancer Res Treat 2009 Nov [PMID: 19048371]

Review for ZEB2 Antibody (NBP1-82991) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Human.
We have 1 review tested in 1 application: WB.

Reviews using NBP1-82991:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot ZEB2 NBP1-82991
Enlarge
reviewed by:
Anonymous
WB Human 11/12/2017
View

Summary

ApplicationWestern Blot
Sample TestedCancer Cell lines
SpeciesHuman
LotB105866

Comments

CommentsSample: Whole cell lysates of various cancer cell lines (10ug)
Blocking: 5% nonfat dry milk reconstituted in TBS-T for 1 hour at room temperature
Primary Antibody diluted (1:500) in 5% nonfat dry milk reconstituted in TBS-T overnight at 4deg C
Secondary Antibody: Goat Anti-Rabbit IgG H&L (HRP) (ab97051) at 1/10000 dilution in TBS-T

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZEB2 Antibody (NBP1-82991) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZEB2 Products

Bioinformatics Tool for ZEB2 Antibody (NBP1-82991)

Discover related pathways, diseases and genes to ZEB2 Antibody (NBP1-82991). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZEB2 Antibody (NBP1-82991)

Discover more about diseases related to ZEB2 Antibody (NBP1-82991).
 

Pathways for ZEB2 Antibody (NBP1-82991)

View related products by pathway.

PTMs for ZEB2 Antibody (NBP1-82991)

Learn more about PTMs related to ZEB2 Antibody (NBP1-82991).
 

Research Areas for ZEB2 Antibody (NBP1-82991)

Find related products by research area.

Blogs on ZEB2

There are no specific blogs for ZEB2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Anonymous
11/12/2017
Application: WB
Species: Human

Bioinformatics

Gene Symbol ZEB2
Entrez