ROBO4 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PAENHNGIIRGYQVWSLGNTSLPPANWTVVGEQTQLEIATHMPGSYCVQVAAVTGAGAGEPSRPVCLLLEQAMERATQEPSEHGPW |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
ROBO4 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
|
| Application Notes |
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Reactivity Notes
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for ROBO4 Antibody - BSA Free
Background
Roundabouts (ROBO) are cell-surface receptors that mediate repulsive signaling mechanisms at the central nervous system midline. However, ROBOs may also mediate attraction mechanisms in the context of vascular development. ROBO4 is a novel roundabout protein which is restricted in expression to endothelial cells in vitro and sites of angiogenesis in vivo. Because it is not expressed on normal endothelial cells in vivo, it is a promising tumor endothelial marker.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu
Applications: BA
Species: Mu
Applications: IHC
Species: Rt
Applications: IHC, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, Flow, ICC, WB
Species: Ch, Hu, Mu, Rb, Rt, Sh
Applications: B/N, Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Mu, Po, Pm, Rt(-)
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO, PLA, WB
Species: Ha, Hu, Mu, Rt
Applications: Block, Flow, IHC, IP, Simple Western, WB
Species: Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Neut, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu, Mu
Applications: IP, Simple Western, WB
Species: Rt
Applications: IHC, WB
Species: Hu
Applications: ICC/IF
Publications for ROBO4 Antibody (NBP2-57071) (0)
There are no publications for ROBO4 Antibody (NBP2-57071).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ROBO4 Antibody (NBP2-57071) (0)
There are no reviews for ROBO4 Antibody (NBP2-57071).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for ROBO4 Antibody (NBP2-57071) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional ROBO4 Products
Research Areas for ROBO4 Antibody (NBP2-57071)
Find related products by research area.
|
Blogs on ROBO4