ROBO4 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: ROBO4 Antibody [NBP2-57071] - Staining of human cell line PC-3 shows localization to plasma membrane. Antibody staining is shown in green.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ROBO4 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ROBO4 Antibody - BSA Free (NBP2-57071) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PAENHNGIIRGYQVWSLGNTSLPPANWTVVGEQTQLEIATHMPGSYCVQVAAVTGAGAGEPSRPVCLLLEQAMERATQEPSEHGPW
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ROBO4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ROBO4 Recombinant Protein Antigen (NBP2-57071PEP)

Reactivity Notes

Mouse (81%), Rat (84%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ROBO4 Antibody - BSA Free

• ECSM4
• FLJ20798
• Magic roundabout
• MGC133352
• MGC133353
• MRB
• ROBO4
• roundabout homolog 4
• roundabout homolog 4, magic roundabout (Drosophila)

Background

Roundabouts (ROBO) are cell-surface receptors that mediate repulsive signaling mechanisms at the central nervous system midline. However, ROBOs may also mediate attraction mechanisms in the context of vascular development. ROBO4 is a novel roundabout protein which is restricted in expression to endothelial cells in vitro and sites of angiogenesis in vivo. Because it is not expressed on normal endothelial cells in vivo, it is a promising tumor endothelial marker.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ROBO4