ROBO4 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ROBO4 Antibody [NBP2-57071] - Staining of human cell line PC-3 shows localization to plasma membrane. Antibody staining is shown in green.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ROBO4 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PAENHNGIIRGYQVWSLGNTSLPPANWTVVGEQTQLEIATHMPGSYCVQVAAVTGAGAGEPSRPVCLLLEQAMERATQEPSEHGPW
Specificity
Specificity of human ROBO4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ROBO4
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Reactivity Notes

Mouse 81%, Rat 84%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for ROBO4 Antibody

  • ECSM4
  • FLJ20798
  • Magic roundabout
  • MGC133352
  • MGC133353
  • MRB
  • ROBO4
  • roundabout homolog 4
  • roundabout homolog 4, magic roundabout (Drosophila)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20398
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP2-13350
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1749
Species: Rt
Applications: WB, IHC
AF3147
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB300-562
Species: Hu, Mu, Rt, Ch, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-P, B/N
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
AF3076
Species: Hu
Applications: WB, IHC
NBP1-60120
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb
Applications: WB, TCS
NBP2-52587
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-164
Species: Hu, Po, Ca, Pm, Rt(-)
Applications: WB, ICC/IF, IHC-Fr, IHC-P, IP
AF933
Species: Hu
Applications: WB, Simple Western, IHC, IP
AF644
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NBP2-37245
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, Flow-IC
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
AF2187
Species: Hu, Mu
Applications: WB, Simple Western, IP
AF1006
Species: Rt
Applications: WB, IHC

Publications for ROBO4 Antibody (NBP2-57071) (0)

There are no publications for ROBO4 Antibody (NBP2-57071).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ROBO4 Antibody (NBP2-57071) (0)

There are no reviews for ROBO4 Antibody (NBP2-57071). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ROBO4 Antibody (NBP2-57071) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ROBO4 Products

Bioinformatics Tool for ROBO4 Antibody (NBP2-57071)

Discover related pathways, diseases and genes to ROBO4 Antibody (NBP2-57071). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ROBO4 Antibody (NBP2-57071)

Discover more about diseases related to ROBO4 Antibody (NBP2-57071).
 

Pathways for ROBO4 Antibody (NBP2-57071)

View related products by pathway.

PTMs for ROBO4 Antibody (NBP2-57071)

Learn more about PTMs related to ROBO4 Antibody (NBP2-57071).
 

Research Areas for ROBO4 Antibody (NBP2-57071)

Find related products by research area.

Blogs on ROBO4

There are no specific blogs for ROBO4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ROBO4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ROBO4