PXR/NR1I2 Antibody


Immunocytochemistry/ Immunofluorescence: PXR/NR1I2 Antibody [NBP2-55441] - Staining of human cell line U-2 OS shows localization to nucleoplasm & nuclear bodies.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF

Order Details

PXR/NR1I2 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RTHHFKEGSLRAPAIPLHSAAAELASNHPRGPEANLEVRPKESWNHADFVHCEDTESVPGKPSVNADE
Specificity of human PXR/NR1I2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PXR/NR1I2 Recombinant Protein Antigen (NBP2-55441PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for PXR/NR1I2 Antibody

  • BXR
  • NR1I2
  • nuclear receptor subfamily 1 group I member 2
  • nuclear receptor subfamily 1, group I, member 2
  • ONR1
  • Orphan nuclear receptor PAR1
  • Orphan nuclear receptor PXR
  • PAR
  • PAR1
  • PAR2
  • Pregnane X receptor
  • PRR
  • PXR
  • SAR
  • Steroid and xenobiotic receptor
  • SXR


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IP
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, ELISA, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, Flow-IC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: GS, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Gp, Rb, Sh, Ye
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, B/N
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, ELISA, ICC/IF

Publications for PXR/NR1I2 Antibody (NBP2-55441) (0)

There are no publications for PXR/NR1I2 Antibody (NBP2-55441).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PXR/NR1I2 Antibody (NBP2-55441) (0)

There are no reviews for PXR/NR1I2 Antibody (NBP2-55441). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PXR/NR1I2 Antibody (NBP2-55441) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional PXR/NR1I2 Products

Bioinformatics Tool for PXR/NR1I2 Antibody (NBP2-55441)

Discover related pathways, diseases and genes to PXR/NR1I2 Antibody (NBP2-55441). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PXR/NR1I2 Antibody (NBP2-55441)

Discover more about diseases related to PXR/NR1I2 Antibody (NBP2-55441).

Pathways for PXR/NR1I2 Antibody (NBP2-55441)

View related products by pathway.

PTMs for PXR/NR1I2 Antibody (NBP2-55441)

Learn more about PTMs related to PXR/NR1I2 Antibody (NBP2-55441).

Research Areas for PXR/NR1I2 Antibody (NBP2-55441)

Find related products by research area.

Blogs on PXR/NR1I2

There are no specific blogs for PXR/NR1I2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PXR/NR1I2 Antibody and receive a gift card or discount.


Gene Symbol NR1I2