PXR/NR1I2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: PXR/NR1I2 Antibody [NBP2-55441] - Staining of human cell line U-2 OS shows localization to nucleoplasm & nuclear bodies.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PXR/NR1I2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RTHHFKEGSLRAPAIPLHSAAAELASNHPRGPEANLEVRPKESWNHADFVHCEDTESVPGKPSVNADE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NR1I2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  PXR/NR1I2 Recombinant Protein Antigen (NBP2-55441PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PXR/NR1I2 Antibody - BSA Free

• BXR
• NR1I2
• nuclear receptor subfamily 1 group I member 2
• nuclear receptor subfamily 1, group I, member 2
• ONR1
• Orphan nuclear receptor PAR1
• Orphan nuclear receptor PXR
• PAR
• PAR1
• PAR2
• Pregnane X receptor
• PRR
• PXR
• PXRPARq
• SAR
• Steroid and xenobiotic receptor
• SXR
• SXRBXR

Background

NR1I2 product belongs to the nuclear receptor superfamily, members of which are transcription factors characterized by a ligand-binding domain and a DNA-binding domain. The encoded protein is a transcriptional regulator of the cytochrome P450 gene CYP3A4, binding to the response element of the CYP3A4 promoter as a heterodimer with the 9-cis retinoic acid receptor RXR. It is activated by a range of compounds that induce CYP3A4, including dexamethasone and rifampicin. Several alternatively spliced transcripts encoding different isoforms, some of which use non-AUG (CUG) translation initiation codon, have been described for this gene. Additional transcript variants exist, however, they have not been fully characterized.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NR1I2