TRIM13 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: TRIM13 Antibody [NBP1-85016] - Analysis in human testis and pancreas tissues. Corresponding TRIM13 RNA-seq data are presented for the same tissues.
Western Blot: TRIM13 Antibody [NBP1-85016] - Analysis in control (vector only transfected HEK293T lysate) and TRIM13 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunohistochemistry-Paraffin: TRIM13 Antibody [NBP1-85016] - Staining of human testis shows moderate dot-like cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: TRIM13 Antibody [NBP1-85016] - Staining of human duodenum shows no positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: TRIM13 Antibody [NBP1-85016] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: TRIM13 Antibody [NBP1-85016] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

TRIM13 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LSRLDTLETSKRKSLQLLTKDSDKVKEFFEKLQHTLDQKKNEILSDFETMKLAVMQAYDPEINKLNTILQEQRMAFNIAEAFKDVSEPIVFLQQMQEFREKIKVIKETPLPPSNLPASPLMKNFDTSQWEDIKLVDVDKLSLP
Predicted Species
Mouse (94%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TRIM13
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TRIM13 Protein (NBP1-85016PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TRIM13 Antibody

  • B-cell chronic lymphocytic leukemia tumor suppressor Leu5
  • CLL-associated RING finger
  • E3 ubiquitin-protein ligase TRIM13
  • EC 6.3.2.-
  • LEU5CAR
  • Leukemia-associated protein 5
  • Putative tumor suppressor RFP2
  • Ret finger protein 2RING finger protein 77
  • RFP2DLEU5
  • RNF77Leu5
  • tripartite motif containing 13
  • tripartite motif protein 13
  • tripartite motif-containing 13
  • Tripartite motif-containing protein 13

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

PP-H4417-00
Species: Hu
Applications: DirELISA, IP, WB
PP-N4111-00
Species: Hu
Applications: IHC, IP, WB
AF7356
Species: Hu, Mu
Applications: CyTOF-ready, Flow, WB
NBP2-37502
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP1-88192
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-01800
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB100-128
Species: Hu, Mu, Rt
Applications: GS, ICC/IF, IHC, IHC-P
NB300-537
Species: Bv, Hu, Mu, Rb, Rt
Applications: ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, KD, WB
PP-A9033A-00
Species: Hu
Applications: DirELISA, IHC, IP, WB
AF1107
Species: Mu
Applications: IHC, WB
H00003347-M01
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
H00001556-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
H00005957-M37
Species: Hu
Applications: ELISA, ICC/IF, WB
NB300-731
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, WB
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
AF2005
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
NBP1-85016
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for TRIM13 Antibody (NBP1-85016) (0)

There are no publications for TRIM13 Antibody (NBP1-85016).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRIM13 Antibody (NBP1-85016) (0)

There are no reviews for TRIM13 Antibody (NBP1-85016). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TRIM13 Antibody (NBP1-85016) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TRIM13 Products

Bioinformatics Tool for TRIM13 Antibody (NBP1-85016)

Discover related pathways, diseases and genes to TRIM13 Antibody (NBP1-85016). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRIM13 Antibody (NBP1-85016)

Discover more about diseases related to TRIM13 Antibody (NBP1-85016).
 

Pathways for TRIM13 Antibody (NBP1-85016)

View related products by pathway.

PTMs for TRIM13 Antibody (NBP1-85016)

Learn more about PTMs related to TRIM13 Antibody (NBP1-85016).
 

Research Areas for TRIM13 Antibody (NBP1-85016)

Find related products by research area.

Blogs on TRIM13

There are no specific blogs for TRIM13, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRIM13 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TRIM13