PAWR / PAR4 Antibody

Images

 
Western Blot: PAWR / PAR4 Antibody [NBP1-87338] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: PAWR / PAR4 Antibody [NBP1-87338] - Immunofluorescent staining of human cell line SiHa shows localization to plasma membrane & actin filaments.
Immunohistochemistry-Paraffin: PAWR / PAR4 Antibody [NBP1-87338] - Staining of human smooth muscle shows cytolasmic positivity in smooth muscle cells.
Western Blot: PAWR / PAR4 Antibody [NBP1-87338] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PAWR / PAR4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LQEPPRTVSGRYKSTTSVSEEDVSSRYSRTDRSGFPRYNRDANVSGTLVSSSTLEKKIEDLEKEVVRERQENLRLVRLMQDKEEMIGKLKEEIDLLNRDLDDIEDENEQLKQENKT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PAWR
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PAWR / PAR4 Protein (NBP1-87338PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PAWR / PAR4 Antibody

  • Par-4
  • PAR4prostate apoptosis response protein 4
  • PRKC apoptosis WT1 regulator protein
  • PRKC, apoptosis, WT1, regulator
  • Prostate apoptosis response 4 protein
  • prostate apoptosis response protein PAR-4
  • transcriptional repressor PAR4
  • WT1-interacting protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
NBP1-71770
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NLS261
Species: Hu
Applications: WB (-), IHC-P, ICC
NBP1-81746
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49382
Species: Hu
Applications: IHC
NBP1-78028
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, ELISA, ICC/IF
MAB3949
Species: Hu
Applications: Flow, CyTOF-ready
19540002
Species: Hu
Applications: ELISA, IHC, IHC-P
NBP1-88861
Species: Hu, Mu
Applications: Simple Western, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-14835
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp

Publications for PAWR / PAR4 Antibody (NBP1-87338) (0)

There are no publications for PAWR / PAR4 Antibody (NBP1-87338).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PAWR / PAR4 Antibody (NBP1-87338) (0)

There are no reviews for PAWR / PAR4 Antibody (NBP1-87338). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PAWR / PAR4 Antibody (NBP1-87338) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PAWR / PAR4 Products

Bioinformatics Tool for PAWR / PAR4 Antibody (NBP1-87338)

Discover related pathways, diseases and genes to PAWR / PAR4 Antibody (NBP1-87338). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PAWR / PAR4 Antibody (NBP1-87338)

Discover more about diseases related to PAWR / PAR4 Antibody (NBP1-87338).
 

Pathways for PAWR / PAR4 Antibody (NBP1-87338)

View related products by pathway.

PTMs for PAWR / PAR4 Antibody (NBP1-87338)

Learn more about PTMs related to PAWR / PAR4 Antibody (NBP1-87338).

Blogs on PAWR / PAR4

There are no specific blogs for PAWR / PAR4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PAWR / PAR4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PAWR
Entrez
Uniprot