POGZ Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: POGZ Antibody [NBP1-83004] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus.
Immunohistochemistry-Paraffin: POGZ Antibody [NBP1-83004] - Staining of human bronchus shows strong membranous and nuclear positivity in respiratory epithelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

POGZ Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PEELLTPLAPALPSPASTATPPPTPTHPQALALPPLATEGAECLNVDDQDEGSPVTQEPELASGGGGSGGVGKKEQLSVKKLRVVLFALCCNTEQAAEHFRNPQRRIRRWLRRFQASQGENLEGKYLSFEAEEKLAEWV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
POGZ
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
POGZ Protein (NBP1-83004PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for POGZ Antibody

  • KIAA0461ZNF635
  • pogo transposable element with ZNF domain
  • putative protein product of Nbla00003
  • SUHW5MGC71543
  • Suppressor of hairy wing homolog 5
  • Zinc finger protein 280E
  • Zinc finger protein 635
  • ZNF280EZNF635m

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-40561
Species: Hu
Applications: WB, IP
NB100-68209
Species: Hu, Mu
Applications: WB, IP, PLA
NB100-294
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, MiAr
NBP1-54446
Species: Hu, Ch
Applications: WB, ELISA, GS, ICC/IF, IP
H00007071-M15
Species: Hu, Mu, Rt
Applications: WB, ELISA
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
NBP1-97868
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, GP, Ha, Mk, Rb, Sh
Applications: WB, EM, EIA, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-21584
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-20704
Species: Hu
Applications: WB, ICC/IF
AF1138
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
AF5789
Species: Hu, Mu, Rt
Applications: WB
AF603
Species: Mu
Applications: WB, Block, ICC
NB100-79843
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, ChIP
NB110-40623
Species: Hu
Applications: WB, ChIP, IHC, IHC-P, IP, PLA
NBP2-27562
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-13883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-18910
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP
MAB224
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut

Publications for POGZ Antibody (NBP1-83004) (0)

There are no publications for POGZ Antibody (NBP1-83004).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for POGZ Antibody (NBP1-83004) (0)

There are no reviews for POGZ Antibody (NBP1-83004). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for POGZ Antibody (NBP1-83004) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional POGZ Products

Bioinformatics Tool for POGZ Antibody (NBP1-83004)

Discover related pathways, diseases and genes to POGZ Antibody (NBP1-83004). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for POGZ Antibody (NBP1-83004)

Discover more about diseases related to POGZ Antibody (NBP1-83004).
 

Pathways for POGZ Antibody (NBP1-83004)

View related products by pathway.

Blogs on POGZ

There are no specific blogs for POGZ, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our POGZ Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol POGZ