POGZ Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: POGZ Antibody [NBP1-83004] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: POGZ Antibody [NBP1-83004] - Staining of human testis shows strong nuclear and cytoplasmic positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: POGZ Antibody [NBP1-83004] - Staining of human cerebral cortex shows moderate to strong nuclear positivity in neurons.

Immunohistochemistry-Paraffin: POGZ Antibody [NBP1-83004] - Staining of human placenta shows moderate to strong nuclear positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: POGZ Antibody [NBP1-83004] - Staining of human rectum shows moderate to strong nuclear positivity in glandular cells.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

POGZ Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PEELLTPLAPALPSPASTATPPPTPTHPQALALPPLATEGAECLNVDDQDEGSPVTQEPELASGGGGSGGVGKKEQLSVKKLRVVLFALCCNTEQAAEHFRNPQRRIRRWLRRFQASQGENLEGKYLSFEAEEKLAEWV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: POGZ
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. Use in Western blot reported in scientific literature (PMID: 31196716).
• Control Peptide:

  POGZ Protein (NBP1-83004PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%), Rat (87%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for POGZ Antibody - BSA Free

• KIAA0461ZNF635
• pogo transposable element with ZNF domain
• putative protein product of Nbla00003
• SUHW5MGC71543
• Suppressor of hairy wing homolog 5
• Zinc finger protein 280E
• Zinc finger protein 635
• ZNF280EZNF635m

Background

Pogz is a zinc-finger protein containing at least 8 C2H2 zinc fingers, a CENP-B (centromere protein-B) domain, and a DDE domain found in the bacterial transposase/retroviral integrase family. Members of this family of integrases share structural homologies and show similar catalytic activity to the RAG1 and RAG2 proteins that initiate V(D)J recombination in lymphoid progenitors. Mouse Pogz has a human homolog with a base pair similarity of 90% and amino acid similarity of 93% for the full length protein. In humans at least 3 variants have been predicted and they are all similar at the Nterminus. A number of expressed sequence tags (ESTs) cloned from murine undifferentiated ES cells and Lin-/c-Kit+/Sca-1+ hematopoietic stem cell cDNA libraries correspond to the Pogz gene, further underlining an important function for this gene in stem cells. In mice, deletion of the gene in all tissues early in embryogenesis has been shown to be lethal.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for POGZ Antibody (NBP1-83004)(2)

Publications using NBP1-83004

• Zhao W, Quan Y, Wu H et al. POGZ de novo missense variants in neuropsychiatric disorders Mol Genet Genomic Med 2019-07-25 [PMID: 31347273] (WB, Human)
• Vihola A, Palmio J, Danielsson O et al. Rare inherited missense variants of POGZ associate with autism risk and disrupt neuronal development Journal of Genetics and Genomics 2019-05-01 [PMID: 31196716] (WB, Human)

Bioinformatics

• Gene Symbol: POGZ