KLF10 Antibody (1H3)

Images

 
Western Blot: KLF10 Antibody (1H3) [H00007071-M15] - Analysis of KLF10 expression in NIH/3T3 (Cat # L018V1).
Western Blot: KLF10 Antibody (1H3) [H00007071-M15] - Analysis of KLF10 expression in PC-12 (Cat # L012V1).
Western Blot: KLF10 Antibody (1H3) [H00007071-M15] - Analysis of KLF10 expression in A-549 (Cat # L025V1).
Western Blot: KLF10 Antibody (1H3) [H00007071-M15] - Analysis of KLF10 expression in Raw 264.7 (Cat # L024V1).
Western Blot: KLF10 Antibody (1H3) [H00007071-M15] - Analysis of KLF10 expression in Y-79 (Cat # L042V1).
Western Blot: KLF10 Antibody (1H3) [H00007071-M15] - Analysis of KLF10 expression in Jurkat (Cat # L017V1).
Western Blot: KLF10 Antibody (1H3) [H00007071-M15] - Analysis of KLF10 expression in human colon.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA
Clone
1H3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

KLF10 Antibody (1H3) Summary

Immunogen
KLF10 (AAH11538.1 111 a.a. - 210 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LSDTAKPHIAAPFKEEEKSPVSAPKLPKAQATSVIRHTADAQLCNHQTCPMKAASILNYQNNSFRRRTHLNVEAARKNIPCAAVSPNRSKCERNTVADVD
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
KLF10
Purity
Ascites
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Ascites

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for KLF10 Antibody (1H3)

  • EGRA
  • EGR-alpha
  • KLF10
  • Krueppel-like factor 10
  • Kruppel-like factor 10
  • TGFB inducible early growth response
  • TGFB-inducible early growth response protein 1
  • TIEG1
  • TIEG-1
  • TIEG1TIEG
  • Transforming growth factor-beta-inducible early growth response protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00008462-M03
Species: Hu, Mu, Rt
Applications: WB, ChIP, ELISA, ICC/IF, IHC-P
NBP2-20460
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, ChIP
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
MAB6799
Species: Hu
Applications: WB, IHC
MAB2029
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
355-BM/CF
Species: Hu, Mu, Rt
H00001958-M03
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IHC-P
AF3797
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, KO
NB100-39002
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
248-BD
Species: Hu, Mu, Rt, Ca, Eq
NBP2-45511
Species: Hu
Applications: WB, IHC
6449-TEC/CF
Species: Hu
AF2097
Species: Hu
Applications: WB, ChIP, ICC
NB100-56104
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
H00007071-M15
Species: Hu, Mu, Rt
Applications: WB, ELISA

Publications for KLF10 (H00007071-M15) (0)

There are no publications for KLF10 (H00007071-M15).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KLF10 (H00007071-M15) (0)

There are no reviews for KLF10 (H00007071-M15). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KLF10 (H00007071-M15) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for KLF10 (H00007071-M15)

Discover related pathways, diseases and genes to KLF10 (H00007071-M15). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KLF10 (H00007071-M15)

Discover more about diseases related to KLF10 (H00007071-M15).
 

Pathways for KLF10 (H00007071-M15)

View related products by pathway.

PTMs for KLF10 (H00007071-M15)

Learn more about PTMs related to KLF10 (H00007071-M15).
 

Research Areas for KLF10 (H00007071-M15)

Find related products by research area.

Blogs on KLF10

There are no specific blogs for KLF10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KLF10 Antibody (1H3) and receive a gift card or discount.

Bioinformatics

Gene Symbol KLF10
Entrez