| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ELISA, ICC/IF |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit alpha-Defensin 1 Antibody - BSA Free (NBP3-05562) is a polyclonal antibody validated for use in IHC, WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-94 of human alpha-Defensin 1 (NP_004075.1). MRTLAILAAILLVALQAQAEPLQARADEVAAAPEQIAADIPEVVVSLAWDESLAPKHPGSRKNMACYCRIPACIAGERRYGTCIYQGRLWAFCC |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | DEFA1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Theoretical MW | 10 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
| Publications |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
| Publication using NBP3-05562 | Applications | Species |
|---|---|---|
| Duan X, Yu Z HNP-1 Reverses Hypertensive Left Ventricular Hypertrophy by Inhibiting the NF-?B Signaling Pathway Cardiovascular Innovations and Applications 2023-08-14 (IHC-P, WB, Rat) Details: 1:80 dilution IHC-P, 1:2000 dilution WB |
IHC-P, WB | Rat |
Secondary Antibodies |
Isotype Controls |
Research Areas for alpha-Defensin 1 Antibody (NBP3-05562)Find related products by research area.
|
|
Toll-like receptors in the intestinal epithelial cells By Jamshed Arslan, Pharm. D., PhD. Toll-like receptors (TLRs) are microbe-sensing proteins that act as first responders to danger signals. TLRs help the intestinal epithelial cells (IECs) recognize commensal bacteria ... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | DEFA1 |