TRIM10 Antibody - BSA Free

Western Blot: TRIM10 Antibody [NBP2-85982] - Host: Rabbit. Target Name: TRIM10. Sample Type: Human Fetal Heart. Antibody Dilution: 1.0ug/ml

Western Blot: TRIM10 Antibody [NBP2-85982] - WB Suggested Anti-TRIM10 Antibody Titration: 5.0ug/ml. ELISA Titer: 1:2500. Positive Control: HepG2 cell lysateThere is BioGPS gene expression data showing that TRIM10 is expressed in HepG2

Western Blot: TRIM10 Antibody [NBP2-85982] - Host: Rabbit. Target Name: TRIM10. Sample Type: Human Fetal Kidney. Antibody Dilution: 1.0ug/ml

Western Blot: TRIM10 Antibody [NBP2-85982] - Host: Rabbit. Target Name: TRIM10. Sample Type: Jurkat. Antibody Dilution: 1.0ug/ml

Western Blot: TRIM10 Antibody [NBP2-85982] - Host: Rabbit. Target Name: TRIM10. Sample Type: MCF7. Antibody Dilution: 1.0ug/ml

Western Blot: TRIM10 Antibody [NBP2-85982] - Host: Rabbit. Target Name: TRIM10. Sample Type: 721_B. Antibody Dilution: 1.0ug/mlThere is BioGPS gene expression data showing that TRIM10 is expressed in 721_B

Western Blot: TRIM10 Antibody [NBP2-85982] - Host: Rabbit. Target Name: TRIM10. Sample Type: Hela. Antibody Dilution: 1.0ug/ml

Western Blot: TRIM10 Antibody [NBP2-85982] - Host: Rabbit. Target Name: TRIM10. Sample Type: Human Fetal Brain. Antibody Dilution: 1.0ug/ml

Western Blot: TRIM10 Antibody [NBP2-85982] - Host: Rabbit. Target Name: TRIM10. Sample Type: Human Fetal Lung. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 1 mg/ml

TRIM10 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TRIM10 Antibody - BSA Free (NBP2-85982) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human TRIM10. Peptide sequence: RVSLDYEVGWVTFTNAVTREPIYTFTASFTRKVIPFFGLWGRGSSFSLSS The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TRIM10
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 1 mg/ml
• Purity: Protein A purified

Alternate Names for TRIM10 Antibody - BSA Free

• B30-RING finger protein
• HERF1hematopoietic RING finger 1
• RFB30MGC141979
• RING finger protein 9
• RNF9tripartite motif protein 10
• tripartite motif containing 10
• tripartite motif-containing 10
• tripartite motif-containing protein 10
• Zn-finger protein

Background

TRIM10 is encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This protein localizes to cytoplasmic bodies. Studies in mice suggest that this protein plays a role in terminal differentiation of erythroid cells. Alternate splicing of this gene generates two transcript variants encoding different isoforms. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TRIM10