SF3A1 Antibody

Images

 
Western Blot: SF3A1 Antibody [NBP1-87214] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp Lane 4: Human plasma (IgG/HSA depleted)Lane 5: Human ...read more
Immunocytochemistry/ Immunofluorescence: SF3A1 Antibody [NBP1-87214] - Immunofluorescent staining of human cell line U-251 MG shows localization to nuclear speckles.
Immunohistochemistry-Paraffin: SF3A1 Antibody [NBP1-87214] - Staining of human breast shows strong nuclear positivity in glandular cells.
Western Blot: SF3A1 Antibody [NBP1-87214] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SF3A1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TEDSLMPEEEFLRRNKGPVSIKVQVPNMQDKTEWKLNGQVLVFTLPLTDQVSVIKVKIHEATGMPAGKQKLQYEGIFIKDSNSLAYYNMANGAVIHLALKESGGRKK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SF3A1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SF3A1 Protein (NBP1-87214PEP)
Publications
Read Publication using
NBP1-87214 in the following applications:

  • WB
    1 publication

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 25586139).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SF3A1 Antibody

  • pre-mRNA processing 21
  • pre-mRNA splicing factor SF3a (120 kDa subunit)
  • Prp21
  • PRPF21
  • SAP 114
  • SAP114splicing factor 3a, subunit 1, 120kD
  • SF3a120
  • spliceosome associated protein 114
  • Spliceosome-associated protein 114
  • splicing factor 3 subunit 1
  • splicing factor 3A subunit 1
  • splicing factor 3a, subunit 1, 120kDa

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87212
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00008175-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP
NB600-501
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, Fi, GP, Ha, Le, Ma, Pm, Rb, Sh, Sq, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-64792
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr
NB100-55245
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-41187
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NB500-317
Species: Hu, Bv(-), Ca(-), Ch(-), Mu(-), Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, RIA
NBP1-71688
Species: Hu, Mu, Po
Applications: WB, Simple Western, ICC/IF
NBP1-71833
Species: Hu, Mu
Applications: WB
NB100-55256
Species: Hu
Applications: WB, IHC-P, IP
NBP2-33600
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83565
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-87799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33280
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-79848
Species: Hu
Applications: WB, IHC, IHC-P, IP
H00007071-M15
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP1-97868
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, GP, Ha, Mk, Rb, Sh
Applications: WB, EM, EIA, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-87677
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-21584
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for SF3A1 Antibody (NBP1-87214)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for SF3A1 Antibody (NBP1-87214) (0)

There are no reviews for SF3A1 Antibody (NBP1-87214). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SF3A1 Antibody (NBP1-87214) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SF3A1 Products

Bioinformatics Tool for SF3A1 Antibody (NBP1-87214)

Discover related pathways, diseases and genes to SF3A1 Antibody (NBP1-87214). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SF3A1 Antibody (NBP1-87214)

Discover more about diseases related to SF3A1 Antibody (NBP1-87214).

Blogs on SF3A1

There are no specific blogs for SF3A1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SF3A1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SF3A1