SF3A1 Antibody

Images

 
Western Blot: SF3A1 Antibody [NBP1-87214] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: SF3A1 Antibody [NBP1-87214] - Staining of human cell line U-251 MG shows localization to nuclear speckles. Antibody staining is shown in green.
Independent Antibodies: Immunohistochemistry-Paraffin: SF3A1 Antibody [NBP1-87214] - Staining of human cerebral cortex, colon, kidney and testis using Anti-SF3A1 antibody NBP1-87214 (A) shows similar protein ...read more
Genetic Strategies: Western Blot: SF3A1 Antibody [NBP1-87214] - Analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1. Remaining relative intensity is presented. Loading ...read more
Immunohistochemistry-Paraffin: SF3A1 Antibody [NBP1-87214] - Staining of human testis using Anti-SF3A1 antibody.
Immunohistochemistry-Paraffin: SF3A1 Antibody [NBP1-87214] - Staining of human cerebral cortex using Anti-SF3A1 antibody.
Immunohistochemistry-Paraffin: SF3A1 Antibody [NBP1-87214] - Staining of human kidney using Anti-SF3A1 antibody.
Immunohistochemistry-Paraffin: SF3A1 Antibody [NBP1-87214] - Staining of human colon using Anti-SF3A1 antibody.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SF3A1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TEDSLMPEEEFLRRNKGPVSIKVQVPNMQDKTEWKLNGQVLVFTLPLTDQVSVIKVKIHEATGMPAGKQKLQYEGIFIKDSNSLAYYNMANGAVIHLALKESGGRKK
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SF3A1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
Application Notes
WB reported in scientific literature (PMID: 25586139). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SF3A1 Protein (NBP1-87214PEP)
Publications
Read Publication using
NBP1-87214 in the following applications:

  • WB
    1 publication

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 25586139).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SF3A1 Antibody

  • pre-mRNA processing 21
  • pre-mRNA splicing factor SF3a (120 kDa subunit)
  • Prp21
  • PRPF21
  • SAP 114
  • SAP114splicing factor 3a, subunit 1, 120kD
  • SF3a120
  • spliceosome associated protein 114
  • Spliceosome-associated protein 114
  • splicing factor 3 subunit 1
  • splicing factor 3A subunit 1
  • splicing factor 3a, subunit 1, 120kDa

Background

SF3A1 encodes subunit 1 of the splicing factor 3a protein complex. The splicing factor 3a heterotrimer includes subunits 1, 2 and 3 and is necessary for the in vitro conversion of 15S U2 snRNP into an active 17S particle that performs pre-mRNA splicing. Subunit 1 belongs to the SURP protein family; named for the SURP (also called SWAP or Suppressor-of-White-APricot) motifs that are thought to mediate RNA binding. Subunit 1 has tandemly repeated SURP motifs in its amino-terminal half while its carboxy-terminal half contains a proline-rich region and a ubiquitin-like domain. Binding studies with truncated subunit 1 derivatives demonstrated that the two SURP motifs are necessary for binding to subunit 3 while contacts with subunit 2 may occur through sequences carboxy-terminal to the SURP motifs. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-94076
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-47281
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NB300-221
Species: Av, Bv, Ca, Ch, ChHa, Dr, Eq, Fe, Ha, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, Sh, Ze
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Simple Western, Single-Cell Western, WB
NB600-501
Species: Bv, Ca, Ch, Dr(-), Fe, Fi, Gp, Ha, Hu, Le, Ma, Mu, Po, Pm, Rb, Rt, Sh, Sq, Tr, Ze
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, Simple Western, WB
NB600-533
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IP, Simple Western, WB
NB100-55245
Species: Hu
Applications: IHC, IHC-P, IP, WB
MAB4219
Species: Hu
Applications: CyTOF-ready, Flow
NB500-317
Species: Bv(-), Ca(-), Ch(-), Hu, Mu(-), Rb(-)
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, IP, RIA, WB
NBP3-13522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-03747
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP2-47291
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-33600
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-83565
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, KD, WB
NBP1-87799
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-33280
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB100-79848
Species: Hu
Applications: IHC, IHC-P, IP, WB
H00007071-M15
Species: Hu, Mu, Rt
Applications: ELISA, WB
NB120-2788
Species: Bv, Fe, Fi, Ha, Hu, Mu, Pm, Rt
Applications: B/N, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-87677
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-24677
Species: Ca, Eq, Hu, Pm
Applications: ICC/IF, IHC, IHC-P, WB

Publications for SF3A1 Antibody (NBP1-87214)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for SF3A1 Antibody (NBP1-87214) (0)

There are no reviews for SF3A1 Antibody (NBP1-87214). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SF3A1 Antibody (NBP1-87214) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SF3A1 Products

Bioinformatics Tool for SF3A1 Antibody (NBP1-87214)

Discover related pathways, diseases and genes to SF3A1 Antibody (NBP1-87214). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SF3A1 Antibody (NBP1-87214)

Discover more about diseases related to SF3A1 Antibody (NBP1-87214).

Blogs on SF3A1

There are no specific blogs for SF3A1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SF3A1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SF3A1