ORP150/HSP12A Antibody

Images

 
Western Blot: ORP150/HSP12A Antibody [NBP2-14113] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: HELA
Immunohistochemistry-Paraffin: ORP150/HSP12A Antibody [NBP2-14113] - Staining of human pancreas shows distinct cytoplasmic positivity in exocrine glandular cells.
Simple Western: ORP150/HSP12A Antibody [NBP2-14113] - Simple Western lane view shows a specific band for ORP150/HSP12A in 0.2 mg/ml of HEL lysate(s). This experiment was performed under reducing conditions using the ...read more
Simple Western: ORP150/HSP12A Antibody [NBP2-14113] - Electropherogram image of the corresponding Simple Western lane view. ORP150/HSP12A antibody was used at 1:25 dilution on HEL lysate(s) respectively.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, Simple Western, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ORP150/HSP12A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VLQLINDNTATALSYGVFRRKDINTTAQNIMFYDMGSGSTVCTIVTYQMV KTKEAGMQPQLQIRGVGFDRTLGGLEMELRLRERLAGLFNEQRKGQRAKD VRENPRAMAKLLREANRLKTVLSANADHMAQIEGLMDDVDFKAKVTRV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HYOU1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Simple Western 1:25
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. In Simple Western only 10-15 uL of the recommended dilution is used per data point.
Control Peptide
ORP150/HSP12A Protein (NBP2-14113PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ORP150/HSP12A Antibody

  • 150 kDa oxygen-regulated protein
  • 170 kDa glucose-regulated protein
  • DKFZp686N08236
  • FLJ97572
  • glucose-regulated protein 170
  • Grp170
  • GRP-170
  • HSP12A
  • HYOU1
  • hypoxia up-regulated 1
  • hypoxia up-regulated protein 1
  • ORP150
  • ORP-150
  • ORP150FLJ94899
  • oxygen regulated protein (150kD)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-06274
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
NB300-619
Species: Hu, Mu, Rt, Bv, Ch, Ha
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-81696
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1543
Species: Hu
Applications: WB, IHC
AF4029
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-84796
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-1335
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, B/N, DB, EM, ICC/IF, IHC, IHC-P, IP, PA
NB120-2928
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-02459
Species: Hu, Mu, Rt, Ch, Dr, Pm
Applications: WB, ELISA, IHC, IHC-P
NB100-1965
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Dr, GP, Rb, Sh, Xp, Ze
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-40256
Species: Hu, Mu, Rt, Fi, Ha, Rb
Applications: WB, ChIP, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP1-77397
Species: Hu, Mu, Rt, Ha, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP2-01652
Species: Hu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P
NBP2-45970
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IHC, IF
NBP2-02377
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00005034-B01P
Species: Hu
Applications: WB, ICC/IF
NBP2-14113
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P

Publications for ORP150/HSP12A Antibody (NBP2-14113) (0)

There are no publications for ORP150/HSP12A Antibody (NBP2-14113).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ORP150/HSP12A Antibody (NBP2-14113) (0)

There are no reviews for ORP150/HSP12A Antibody (NBP2-14113). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ORP150/HSP12A Antibody (NBP2-14113) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ORP150/HSP12A Products

Bioinformatics Tool for ORP150/HSP12A Antibody (NBP2-14113)

Discover related pathways, diseases and genes to ORP150/HSP12A Antibody (NBP2-14113). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ORP150/HSP12A Antibody (NBP2-14113)

Discover more about diseases related to ORP150/HSP12A Antibody (NBP2-14113).
 

Pathways for ORP150/HSP12A Antibody (NBP2-14113)

View related products by pathway.

PTMs for ORP150/HSP12A Antibody (NBP2-14113)

Learn more about PTMs related to ORP150/HSP12A Antibody (NBP2-14113).
 

Research Areas for ORP150/HSP12A Antibody (NBP2-14113)

Find related products by research area.

Blogs on ORP150/HSP12A

There are no specific blogs for ORP150/HSP12A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ORP150/HSP12A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HYOU1
Entrez