ERp57/PDIA3 Antibody

Immunohistochemistry-Paraffin: ERp57/PDIA3 Antibody [NBP1-84796] - Staining in human thyroid gland and skeletal muscle tissues using NBP1-84796 antibody. Corresponding PDIA3 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: ERp57/PDIA3 Antibody [NBP1-84796] - Staining of human gastrointestinal, prostate, skeletal muscle and thyroid gland using Anti-PDIA3 antibody NBP1-84796 (A) shows similar protein distribution across tissues to independent antibody NBP1-84797 (B).

Western Blot: ERp57/PDIA3 Antibody [NBP1-84796] - Analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-PDIA3 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.

Western Blot: ERp57/PDIA3 Antibody [NBP1-84796] - Analysis using Anti-PDIA3 antibody NBP1-84796 (A) shows similar pattern to independent antibody NBP1-84797 (B).

Immunocytochemistry/Immunofluorescence: ERp57/PDIA3 Antibody [NBP1-84796] - Staining of human cell line U-2 OS shows localization to endoplasmic reticulum. Antibody staining is shown in green.

Western Blot: ERp57/PDIA3 Antibody [NBP1-84796] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Immunohistochemistry-Paraffin: ERp57/PDIA3 Antibody [NBP1-84796] - Staining of human prostate shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: ERp57/PDIA3 Antibody [NBP1-84796] - Staining of human skeletal muscle shows no cytoplasmic positivity in myocytes as expected.

Immunohistochemistry-Paraffin: ERp57/PDIA3 Antibody [NBP1-84796] - Staining of human small intestine shows moderate to strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: ERp57/PDIA3 Antibody [NBP1-84796] - Staining of human thyroid gland shows strong cytoplasmic positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, KD
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

ERp57/PDIA3 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PTLKIFRDGEEAGAYDGPRTADGIVSHLKKQAGPASVPLRTEEEFKKFISDKDASIVGFFDDSFSEAHSEFLKAASNLRDNYRFAHTNVESLVNEYDDNGEGIILFRPSHLTNKFEDK
• Marker: Endoplasmic Reticulum Marker
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PDIA3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
  • Knockdown Validated
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: WB reported in scientific literature (PMID: 25699251). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ERp57/PDIA3 Protein (NBP1-84796PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24336167).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ERp57/PDIA3 Antibody

• Disulfide isomerase ER-60
• EC 5.3.4.1
• endoplasmic reticulum P58
• Endoplasmic reticulum resident protein 57
• Endoplasmic reticulum resident protein 60
• ER protein 60
• ER60
• ERp57
• ERp5758 kDa glucose-regulated protein
• ERp60
• ERp6058 kDa microsomal protein
• ERp61
• glucose regulated protein, 58kDa
• GRP57
• GRP58
• GRP58ER protein 57
• HsT17083
• P58
• PDIA3
• phospholipase C-alpha
• PI-PLC
• protein disulfide isomerase family A, member 3
• protein disulfide isomerase-associated 3
• protein disulfide-isomerase A3

Background

ERp57, also known as Glucose Regulated Protein 58 (Grp58), Hormone-Induced Protein-70 (HIP-70) and microsomal Carnitine Palmitoyltransferase, is a member of the protein disulfide isomerase family, containing two canonical CXHC tetrapeptide active site motifs (1-5). It has quite a few diverse roles. It functions as an accessory oxidoreductase involved in disulfide bond formation. In the ER, ERp57 interacts with membrane bound calnexin and soluble calreticulin (lectin chaperones) via their praline rich P-domain arms. Lectin chaperones bind nascent non-native glycoproteins, and position ERp57 to act upon the immature or misfolded glycoproteins that possess mono-glucosylated side chains. ERp57 deletion impairs posttranslational phases of influenza hema-glutinin folding, and causes accelerated release of MHC-I molecules, resulting in the coupling of sub-optimal peptides and reduced expression and stability on the cell surface (6). ERp57 also contains two thioredoxin active-site sequences, CGHC and an estrogen-binding domain. ERp57 is induced by both estrogen and leuteinizing-hormone-releasing hormone in the hippocampus (7).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ERp57/PDIA3 Antibody (NBP1-84796)(4)

Publications using NBP1-84796

• Bechor E, Dahan I, Fradin T et al. The dehydrogenase region of the NADPH oxidase component Nox2 acts as a protein disulfide isomerase (PDI) resembling PDIA3 with a role in the binding of the activator protein p67phox. Front Chem 2015-01-01 [PMID: 25699251] (WB, Human)
• Feng H, Li X, Chan V, Chen WN. Proteomics Based Identification of Cell Migration Related Proteins in HBV Expressing HepG2 Cells. PLoS One 2014-01-01 [PMID: 24763314] (WB)
• Logan CV, Szabadkai G, Sharpe JA et al. Loss-of-function mutations in MICU1 cause a brain and muscle disorder linked to primary alterations in mitochondrial calcium signaling. Nat Genet 2014-02-01 [PMID: 24336167]
• Racape M, Duong Van Huyen JP, Danger R et al. The involvement of SMILE/TMTC3 in endoplasmic reticulum stress response. PLoS One 2011-01-01 [PMID: 21603654]

Bioinformatics

• Gene Symbol: PDIA3