Home » ERp57/PDIA3 » ERp57/PDIA3 Antibodies » ERp57/PDIA3 Antibody

ERp57/PDIA3 Antibody

 (4 Publications)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: ERp57/PDIA3 Antibody [NBP1-84796] - Analysis using Anti-PDIA3 antibody NBP1-84796 (A) shows similar pattern to independent antibody NBP1-84797 (B).
Independent Antibodies: Western Blot: ERp57/PDIA3 Antibody [NBP1-84796] - Analysis using Anti-PDIA3 antibody NBP1-84796 (A) shows similar pattern to independent antibody NBP1-84797 (B).
Immunocytochemistry/ Immunofluorescence: ERp57/PDIA3 Antibody [NBP1-84796] - Staining of human cell line U-2 OS shows localization to endoplasmic reticulum. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ERp57/PDIA3 Antibody [NBP1-84796] - Staining in human thyroid gland and skeletal muscle tissues using NBP1-84796 antibody. Corresponding PDIA3 RNA-seq data are presented for the same ...read more
Western Blot: ERp57/PDIA3 Antibody [NBP1-84796] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Genetic Strategies: Western Blot: ERp57/PDIA3 Antibody [NBP1-84796] - Analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-PDIA3 antibody. Remaining relative ...read more
Immunohistochemistry-Paraffin: ERp57/PDIA3 Antibody [NBP1-84796] - Staining of human gastrointestinal, prostate, skeletal muscle and thyroid gland using Anti-PDIA3 antibody NBP1-84796 (A) shows similar protein ...read more
Immunohistochemistry-Paraffin: ERp57/PDIA3 Antibody [NBP1-84796] - Staining of human prostate shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: ERp57/PDIA3 Antibody [NBP1-84796] - Staining of human skeletal muscle shows no cytoplasmic positivity in myocytes as expected.
Immunohistochemistry-Paraffin: ERp57/PDIA3 Antibody [NBP1-84796] - Staining of human small intestine shows moderate to strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: ERp57/PDIA3 Antibody [NBP1-84796] - Staining of human thyroid gland shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

    

Genetic Strategies

    

Order Details

100% Guarantee on every product

ERp57/PDIA3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PTLKIFRDGEEAGAYDGPRTADGIVSHLKKQAGPASVPLRTEEEFKKFISDKDASIVGFFDDSFSEAHSEFLKAASNLRDNYRFAHTNVESLVNEYDDNGEGIILFRPSHLTNKFEDK
Marker
Endoplasmic Reticulum Marker
Specificity
Specificity of human ERp57/PDIA3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PDIA3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.04 - 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Knockdown Validated
Application Notes
WB reported in scientific literature (PMID: 25699251). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ERp57/PDIA3 Protein (NBP1-84796PEP)
Publications
Read Publications using
NBP1-84796 in the following applications:

  • WB
    2 publications

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24336167).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ERp57/PDIA3 Antibody

  • Disulfide isomerase ER-60
  • EC 5.3.4.1
  • endoplasmic reticulum P58
  • Endoplasmic reticulum resident protein 57
  • Endoplasmic reticulum resident protein 60
  • ER protein 60
  • ER60
  • ERp57
  • ERp5758 kDa glucose-regulated protein
  • ERp60
  • ERp6058 kDa microsomal protein
  • ERp61
  • glucose regulated protein, 58kDa
  • GRP57
  • GRP58
  • GRP58ER protein 57
  • HsT17083
  • P58
  • PDIA3
  • phospholipase C-alpha
  • PI-PLC
  • protein disulfide isomerase family A, member 3
  • protein disulfide isomerase-associated 3
  • protein disulfide-isomerase A3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

PLC-gamma 1
Antibody (3H1C10)
NBP2-52533
Western Blot: PLC-gamma 1 Antibody (3H1C10) [NBP2-52533] - Analysis using PLCG1 mouse mAb against NIH/3T3 (1), Jurkat (2), A431 (3), and Hela (4) cell lysate.
Immunocytochemistry/Immunofluorescence: PLC-gamma 1 Antibody (3H1C10) [NBP2-52533] - Analysis of Hela cells using PLCG1 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor- 555 phalloidin.
Immunohistochemistry-Paraffin: PLC-gamma 1 Antibody (3H1C10) [NBP2-52533] - Analysis of paraffin-embedded esophagus tissues using PLCG1 mouse mAb with DAB staining.
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
Calreticulin
Antibody
NB600-101
Knockdown Validated: Calreticulin Antibody [NB600-101] - Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and Calreticulin knockout (KO) HeLa cell line. PVDF membrane was probed with 1:1500 of Rabbit Anti-Human Calreticulin Polyclonal Antibody (Catalog # NB600-101) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog #HAF008). Specific band was detected for Calreticulin at approximately 55 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.
Western Blot: Calreticulin Antibody [NB600-101] - Human kidney lysate.
Immunocytochemistry/Immunofluorescence: Calreticulin Antibody [NB600-101] - Immunofluorescence staining of Calreticulin in HCT15 colon cancer cells using NB600-101. Secondary antibody was conjugated with Alexa Fluor 488. Photo courtesy of Dr. Birkenkamp Demtroeder, Arhus University Hospital.
(25 Publications)
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, DB, EM, Flow, ICC/IF, IHC, IHC-P, IP, PA, B/N, KD
Calnexin Antibody
NB100-1965
Western Blot: Calnexin Antibody [NB100-1965] - WB analysis of CANX in cell lysates as noted.
Western Blot: Calnexin Antibody [NB100-1965] - Subcellular localization of TM6SF2.Immunoaffinity isolation of ER and Golgi complex from mouse liver. ER and Golgi fractions were prepared from mouse liver microsomes by immunoaffinity chromatography as described under Experimental Procedures. Microsome membranes were dissolved in RIPA buffer, and equal volumes were separated on 10% SDS-PAGE and immunoblotting as described under Experimental Procedures. BiP, binding immunoglobulin protein; Gos28, Golgi SNAP receptor complex member 1; *, nonspecific band. Image collected and cropped by Cite Ab from the following publication (Inactivation of Tm6sf2, a Gene Defective in Fatty Liver Disease, Impairs Lipidation but Not Secretion of Very Low Density Lipoproteins. J Biol Chem (2016) licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: Calnexin Antibody [NB100-1965] - Calnexin antibody (1:50) was tested in HeLa cells with Dylight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red).
(1 Review)
(24 Publications)
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Dr, Gp, Rb, Sh, Xp, Ze
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
Glucose 6
phosphate isomerase A ...
NBP2-02541
Western Blot: Glucose 6 phosphate isomerase Antibody (2D2) [NBP2-02541] Analysis of extracts (35ug) from 9 different cell lines by using anti-Glucose 6 phosphate isomerasemonoclonal antibody.
Immunocytochemistry/Immunofluorescence: Glucose 6 phosphate isomerase Antibody (2D2) [NBP2-02541] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY Glucose 6 phosphate isomerase.
Immunohistochemistry-Paraffin: Glucose 6 phosphate isomerase Antibody (2D2) [NBP2-02541] - Staining of paraffin-embedded Human prostate tissue using anti-Glucose 6 phosphate isomerasemouse monoclonal antibody.
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
GNPDA1 Antibody
NBP2-24653
Western Blot: GNPDA1 Antibody [NBP2-24653] - analysis of GNPDA1 in human spleen lysate in the 1) absence and 2) presence of immunizing peptide 3) mouse spleen and 4) rat spleen using GNPDA1 antibody at 1.0 ug/ml, 0.5 ug/ml and 0.5 ug/ml, respectively.
Immunohistochemistry-Paraffin: GNPDA1 Antibody [NBP2-24653] - Formalin-fixed paraffin-embedded human kidney tissue stained with GNPDA1 antibody at 10 ug/ml. Staining of formalin-fixed tissues is enhanced by boiling tissue sections in 10 mM sodium citrate buffer, pH 6.0 for 10-20 min followed by cooling at RT for 20 min.
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
TXNDC15 Antibody
NBP1-89394
Immunocytochemistry/Immunofluorescence: TXNDC15 Antibody [NBP1-89394] - Immunofluorescent staining of human cell line A-431 shows localization to the Golgi apparatus.
Immunohistochemistry-Paraffin: TXNDC15 Antibody [NBP1-89394] - Staining of human colon shows cytoplasmic positivity with a granular pattern in glandular cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
GRP78/HSPA5
Antibody
NBP1-06274
Simple Western: GRP78/HSPA5 Antibody [NBP1-06274] - Image shows a specific band for GRP78 in 0.1 mg/mL of HeLa lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
Western Blot: GRP78/HSPA5 Antibody [NBP1-06274] - C. elegans granulins impair organismal fitness and resistance to ER stress. Total worm lysates from synchronized day 1 adult granulin-expressing animals were immunoblotted with an anti-GRP78/HSPA5 antibody (3 biological replicates). Anti-actin was used as a loading control. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pgen.1008295), licensed under a CC-BY licence.
Western Blot: GRP78/HSPA5 Antibody [NBP1-06274] - Analysis of MAM-associated protein levels in control and patients' fibroblasts.(A) Equal amounts from one control and the five patients were loaded (50 ug of total cell lysates) and subjected to Western Blot with anti-Grp75, anti-sigma-1R and anti-Mfn2 antibodies. We used anti-GAPDH antibody to ensure equal amounts of protein loaded in each lane. This result is representative of three independent experiments. PLoS One. 2016 Mar 9;11(3):e0150357. doi: 10.1371/journal.pone.0150357
(2 Reviews)
(26 Publications)
Species: Hu, Mu, Rt, Ce, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IHC-FrFl

Endorepellin/Perlecan/ ...
AF2364
Endorepellin/Perlecan was detected in immersion fixed paraffin-embedded sections of human skin using 5 µg/mL Goat Anti-Human Endorepellin/Perlecan Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2364) overnight at 4 °C. Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(5 Reviews)
(3 Publications)
Species: Hu
Applications: WB, IHC
Protein Disulfide
Isomerase/P4HB Antibo ...
H00005034-B01P
Western Blot: Protein Disulfide Isomerase/P4HB Antibody [H00005034-B01P] - Analysis of P4HB expression in human liver.
Immunocytochemistry/Immunofluorescence: Protein Disulfide Isomerase/P4HB Antibody [H00005034-B01P] - Analysis of purified antibody to P4HB on HeLa cell. (antibody concentration 10 ug/ml)
Western Blot: Protein Disulfide Isomerase/P4HB Antibody [H00005034-B01P] - Analysis of P4HB expression in HeLa.
(1 Review)
(2 Publications)
Species: Hu
Applications: WB, ICC/IF
Tapasin Antibody
NBP1-59071
Western Blot: Tapasin Antibody [NBP1-59071] - Antibody Titration: 1 ug/ml Human liver.
Immunocytochemistry/Immunofluorescence: Tapasin Antibody [NBP1-59071] - Human Adult liver Observed Staining: Cytoplasmic Primary Antibody Concentration: 1 : 600 Secondary Antibody: Donkey anti-Rabbit-Cy2/3 Secondary Antibody Concentration: 1 : 200 Magnification: 20X Exposure Time: 0.5 2.0 secProtocol located in Reviews and Data.
Immunohistochemistry-Paraffin: Tapasin Antibody [NBP1-59071] - Human Skin Tissue Squamous epithelial cells (Indicated with Arrows), 4-8ug/ml.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
PRRT2 Antibody
NBP2-82026
Western Blot: PRRT2 Antibody [NBP2-82026] - Analysis of PRRT2 in mouse brain tissue lysate with PRRT2 antibody at 1 ug/ml.
Immunocytochemistry/Immunofluorescence: PRRT2 Antibody [NBP2-82026] - Immunofluorescence of PRRT2 in rat brain tissue with PRRT2 antibody at 20 ug/ml.
Immunohistochemistry: PRRT2 Antibody [NBP2-82026] - Immunohistochemistry of PRRT2 in rat brain tissue with PRRT2 antibody at 2.5 ug/ml.
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
PDI Antibody (RL90)
NB300-517
Western Blot: PDI Antibody (RL90) [NB300-517] - Analysis of PDI was performed by loading 25 ug of HepG2 (Lane 1), Hela (Lane 2) and NIH-3T3 (Lane 3) cell lysates.
Immunocytochemistry/Immunofluorescence: PDI Antibody (RL90) [NB300-517] - Staining of Phalloidin (purple) and PDI (green) in NIH 3T3 cells. Formalin fixed cells were permeabilized with 0.1% Triton X-100 in PBS for 10 minutes at room temperature and blocked with 2% BSA in PBS + 0.1% Triton X-100 for 30 minutes at room temperature. Cells were probed with a PDI monoclonal antibody at a dilution of 1:75 for at least 1 hour at room temperature, washed with PBS, and incubated with DyLight 488 goat anti-mouse IgG secondary antibody at a dilution of 1:250 for 30 minutes at room temperature. Actin was stained with DyLight 650 Phalloidin at a dilution of 1:120 (2.5 units/ml final concentration) and nuclei (blue) were stained with Hoechst at a concentration of 1ug/ml for 30 minutes.
Immunohistochemistry-Paraffin: PDI Antibody (RL90) [NB300-517] - Both normal and cancer biopsies of deparaffinized Human colon tissue tissues.
(3 Reviews)
(21 Publications)
Species: Hu, Mu, Rt, Po, Bv, Ha, Pm, Pm, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IM, IP, B/N, KD
PADI1 Antibody
NBP2-37761
Immunocytochemistry/Immunofluorescence: PADI1 Antibody [NBP2-37761] - Staining of human cell line HaCaT shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: PADI1 Antibody [NBP2-37761] - Staining of human colon shows low expression as expected.
Immunohistochemistry-Paraffin: PADI1 Antibody [NBP2-37761] - Staining of human esophagus shows cytoplasmic and nuclear positivity in squamous epithelial cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
SEC14L2 Antibody
(OTI4H2)
NBP2-01346
Western Blot: SEC14L2 Antibody (4H2) [NBP2-01346] Analysis of extracts (35ug) from 9 different cell lines by using anti-SEC14L2 monoclonal antibody.
Immunocytochemistry/Immunofluorescence: SEC14L2 Antibody (4H2) [NBP2-01346] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY SEC14L2.
Immunohistochemistry-Paraffin: SEC14L2 Antibody (4H2) [NBP2-01346] - Staining of paraffin-embedded Human prostate tissue using anti-SEC14L2 mouse monoclonal antibody.
Species: Hu, Mu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
TAP1 Antibody (3D4)
H00006890-M04
Immunocytochemistry/Immunofluorescence: TAP1 Antibody (3D4) [H00006890-M04] - Analysis of monoclonal antibody to TAP1 on HeLa cell. Antibody concentration 10 ug/ml
Flow Cytometry: TAP1 Antibody (3D4) [H00006890-M04] - Intracellular flow cytometric analysis of TAP1 antibody H00006890-M04 (orange filled) on interferon gamma treated HCT116 cells. Red dotted line in histogram represents unstained and blue filled line represents isotype control. Flow cytometry image added from a verified customer review.
(1 Review)
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
ERK2 Antibody
(191801) [Unconjugate
MAB1230
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line, MCF‑7 human breast cancer cell line, U937 human histiocytic lymphoma cell line,PC‑12 rat adrenal pheochromocytoma cell line, and NIH‑3T3 mouse embryonic fibroblast cell line. PVDF membrane was probed with 1 µg/mL of Mouse Anti-Human/Mouse/Rat ERK2 Monoclonal Antibody (Catalog # MAB1230) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for ERK2 at approximately 44 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
ERK2 was detected in immersion fixed 3T3‑L1 mouse embryonic fibroblast adipose-like cell line using Mouse Anti-Human/Mouse/Rat ERK2 Monoclonal Antibody (Catalog # MAB1230) at 3 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm and nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Simple Western lane view shows lysates of HeLa human cervical epithelial carcinoma cell line and MCF‑7 human breast cancer cell line, loaded at 0.5 mg/mL. A specific band was detected for ERK2 at approximately 43 kDa (as indicated) using 10 µg/mL of Mouse Anti-Human/Mouse/Rat ERK2 Monoclonal Antibody (Catalog # MAB1230). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
BMP-3b/GDF-10
Antibody [Unconjugate
AF1543
BMP-3b/GDF-10 Antibody [Unconjugated]
(1 Publication)
Species: Hu
Applications: WB, IHC
VDP p115 Antibody
(3F4)
H00008615-M03
Western Blot: VDP p115 Antibody (3F4) [H00008615-M03] - Analysis of USO1 expression in HeLa (Cat # L013V1).
Immunocytochemistry/Immunofluorescence: VDP p115 Antibody (3F4) [H00008615-M03] - Analysis of monoclonal antibody to USO1 on HeLa cell. Antibody concentration 10 ug/ml
Immunohistochemistry-Paraffin: VDP p115 Antibody (3F4) [H00008615-M03] - Analysis of monoclonal antibody to USO1 on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 3 ug/ml
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
Filamin B Antibody
NBP1-90286
Western Blot: Filamin B Antibody [NBP1-90286] - Analysis in human cell lines A-549 and HEK293 using anti-FLNB antibody. Corresponding FLNB RNA-seq data are presented for the same cell lines. Loading control: anti-HSP90B1.
Immunocytochemistry/Immunofluorescence: Filamin B Antibody [NBP1-90286] - Staining of human cell line U-2 OS shows localization to plasma membrane and cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Filamin B Antibody [NBP1-90286] - Analysis in human prostate and skeletal muscle tissues using NBP1-90286 antibody. Corresponding Filamin B RNA-seq data are presented for the same tissues.
(2 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NXF1 Antibody
NBP1-31649
Western Blot: NXF1 Antibody [NBP1-31649] - Sample (30 ug of whole cell lysate) A: Hela B: Molt-4 7. 5% SDS PAGE; antibody diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: NXF1 Antibody [NBP1-31649] - Paraformaldehyde-fixed HeLa, using antibody at 1:200 dilution.
Immunohistochemistry-Paraffin: NXF1 Antibody [NBP1-31649] - Paraffin-embedded NCIN87 Xenograft, using antibody at 1:100 dilution.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ERp57/PDIA3 Antibody (NBP1-84796)(4)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(2)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for ERp57/PDIA3 Antibody (NBP1-84796) (0)

There are no reviews for ERp57/PDIA3 Antibody (NBP1-84796). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ERp57/PDIA3 Antibody (NBP1-84796) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional ERp57/PDIA3 Products

Bioinformatics Tool for ERp57/PDIA3 Antibody (NBP1-84796)

Discover related pathways, diseases and genes to ERp57/PDIA3 Antibody (NBP1-84796). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ERp57/PDIA3 Antibody (NBP1-84796)

Discover more about diseases related to ERp57/PDIA3 Antibody (NBP1-84796).
 

Pathways for ERp57/PDIA3 Antibody (NBP1-84796)

View related products by pathway.

PTMs for ERp57/PDIA3 Antibody (NBP1-84796)

Learn more about PTMs related to ERp57/PDIA3 Antibody (NBP1-84796).
 

Research Areas for ERp57/PDIA3 Antibody (NBP1-84796)

Find related products by research area.

Blogs on ERp57/PDIA3

There are no specific blogs for ERp57/PDIA3, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ERp57/PDIA3 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol PDIA3