Home » ERp57/PDIA3 » ERp57/PDIA3 Antibodies » ERp57/PDIA3 Antibody

ERp57/PDIA3 Antibody

 (4 Publications)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Immunohistochemistry-Paraffin: ERp57/PDIA3 Antibody [NBP1-84796] - Staining in human thyroid gland and skeletal muscle tissues using NBP1-84796 antibody. Corresponding PDIA3 RNA-seq data are presented for the same tissues.
Orthogonal Strategies: Immunohistochemistry-Paraffin: ERp57/PDIA3 Antibody [NBP1-84796] - Staining in human thyroid gland and skeletal muscle tissues using NBP1-84796 antibody. Corresponding PDIA3 RNA-seq data ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: ERp57/PDIA3 Antibody [NBP1-84796] - Staining of human gastrointestinal, prostate, skeletal muscle and thyroid gland using Anti-PDIA3 antibody NBP1-84796 (A) ...read more
Genetic Strategies: Western Blot: ERp57/PDIA3 Antibody [NBP1-84796] - Analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-PDIA3 antibody. Remaining relative ...read more
Independent Antibodies: Western Blot: ERp57/PDIA3 Antibody [NBP1-84796] - Analysis using Anti-PDIA3 antibody NBP1-84796 (A) shows similar pattern to independent antibody NBP1-84797 (B).
Immunocytochemistry/ Immunofluorescence: ERp57/PDIA3 Antibody [NBP1-84796] - Staining of human cell line U-2 OS shows localization to endoplasmic reticulum. Antibody staining is shown in green.
Western Blot: ERp57/PDIA3 Antibody [NBP1-84796] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: ERp57/PDIA3 Antibody [NBP1-84796] - Staining of human prostate shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: ERp57/PDIA3 Antibody [NBP1-84796] - Staining of human skeletal muscle shows no cytoplasmic positivity in myocytes as expected.
Immunohistochemistry-Paraffin: ERp57/PDIA3 Antibody [NBP1-84796] - Staining of human small intestine shows moderate to strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: ERp57/PDIA3 Antibody [NBP1-84796] - Staining of human thyroid gland shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

    

Genetic Strategies

  

Orthogonal Strategies

  

Order Details

100% Guarantee on every product

ERp57/PDIA3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PTLKIFRDGEEAGAYDGPRTADGIVSHLKKQAGPASVPLRTEEEFKKFISDKDASIVGFFDDSFSEAHSEFLKAASNLRDNYRFAHTNVESLVNEYDDNGEGIILFRPSHLTNKFEDK
Marker
Endoplasmic Reticulum Marker
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PDIA3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
  • Knockdown Validated
  • Western Blot 0.04 - 0.4 ug/ml
Application Notes
WB reported in scientific literature (PMID: 25699251). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ERp57/PDIA3 Protein (NBP1-84796PEP)
Publications
Read Publications using
NBP1-84796 in the following applications:

  • WB
    2 publications

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24336167).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ERp57/PDIA3 Antibody

  • Disulfide isomerase ER-60
  • EC 5.3.4.1
  • endoplasmic reticulum P58
  • Endoplasmic reticulum resident protein 57
  • Endoplasmic reticulum resident protein 60
  • ER protein 60
  • ER60
  • ERp57
  • ERp5758 kDa glucose-regulated protein
  • ERp60
  • ERp6058 kDa microsomal protein
  • ERp61
  • glucose regulated protein, 58kDa
  • GRP57
  • GRP58
  • GRP58ER protein 57
  • HsT17083
  • P58
  • PDIA3
  • phospholipase C-alpha
  • PI-PLC
  • protein disulfide isomerase family A, member 3
  • protein disulfide isomerase-associated 3
  • protein disulfide-isomerase A3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

PLC-gamma 1
Antibody (3C2D11) - B ...
NBP2-52532
ELISA: PLC-gamma 1 Antibody (3C2D11) [NBP2-52532] - Black line: Control Antigen (100 ng); Purple line: Antigen(10ng); Blue line: Antigen (50 ng); Red line: Antigen (100 ng).
Flow Cytometry: PLC-gamma 1 Antibody (3C2D11) [NBP2-52532] - Analysis of Jurkat cells using PLCG1 mouse mAb (green) and negative control (red).
Immunocytochemistry/Immunofluorescence: PLC-gamma 1 Antibody (3C2D11) [NBP2-52532] - Analysis of HeLa cells using PLCG1 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor- 555 phalloidin.
Species: Hu, Pm, Rt
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Calreticulin
Antibody - BSA Free
NB600-101
Knockdown Validated: Calreticulin Antibody [NB600-101] - Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and Calreticulin knockout (KO) HeLa cell line. PVDF membrane was probed with 1:1500 of Rabbit Anti-Human Calreticulin Polyclonal Antibody (Catalog # NB600-101) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog #HAF008). Specific band was detected for Calreticulin at approximately 55 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.
Western Blot: Calreticulin Antibody [NB600-101] - Human kidney lysate.
Immunocytochemistry/Immunofluorescence: Calreticulin Antibody [NB600-101] - The Calreticulin antibody NB600-101 was tested in HeLa cells at a 1:250 dilution against DyLight 488 (Green). Alpha-tubulin and nuclei were counterstained against DyLight 550 (Red) and DAPI (Blue), respectively.
(27 Publications)
Species: Bv, Ha, Hu, Mu, Pm, Rt
Applications: B/N, DB, EM, Flow, ICC/IF, IHC, IHC-P, IP, KD, PA, Simple Western, WB
Calnexin Antibody
- BSA Free
NB100-1965
Western Blot: Calnexin Antibody [NB100-1965] - Subcellular localization of TM6SF2.Immunoaffinity isolation of ER and Golgi complex from mouse liver. ER and Golgi fractions were prepared from mouse liver microsomes by immunoaffinity chromatography as described under Experimental Procedures. Microsome membranes were dissolved in RIPA buffer, and equal volumes were separated on 10% SDS-PAGE and immunoblotting as described under Experimental Procedures. BiP, binding immunoglobulin protein; Gos28, Golgi SNAP receptor complex member 1; *, nonspecific band. Image collected and cropped by Citeab from the following publication (Inactivation of Tm6sf2, a Gene Defective in Fatty Liver Disease, Impairs Lipidation but Not Secretion of Very Low Density Lipoproteins. J Biol Chem (2016) licensed under a CC-BY licence.
Immunohistochemistry: Calnexin Antibody [NB100-1965] - Calnexin immunostaining in the anterior (AI) and mid (MI) intestine of ctrl (control zebrafish), D.I.O. (diet-induced obesity zebrafish), D.I.O. flw 3,5-T2 (D.I.O. zebrafish followed by 3,5-T2), D.I.O. with 3,5-T2 (D.I.O. zebrafish treated with 3,5-T2). (A) AI of ctrl zebrafish (B) AI of D.I.O. (C) AI of D.I.O. flw 3,5-T2. (D) AI of D.I.O. with 3,5-T2. The arrows indicate calnexin immunoexpression in the enteroendocrine and goblet cells. Image collected and cropped by CiteAb from the following publication (https://www.mdpi.com/2076-2615/10/7/1131/htm#) licensed under a CC-BY licence.
Immunohistochemistry: Calnexin Antibody [NB100-1965] - IHC analysis of CANX in mouse prostate using DAB with hematoxylin counterstain.
(3 Reviews)
(30 Publications)
Species: Av, Bv, Ch, Dr, Gp, Hu, Mu, Po, Rb, Rt, Sh, Xp, Ze
Applications: Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Glucose 6
phosphate isomerase A ...
NBP2-02541
Western Blot: Glucose 6 phosphate isomerase Antibody (2D2) [NBP2-02541] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Glucose 6 phosphate isomerase(Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Glucose 6 phosphate isomerase.
Immunohistochemistry-Paraffin: Glucose 6 phosphate isomerase Antibody (2D2) [NBP2-02541] - Staining of paraffin-embedded Adenocarcinoma of Human ovary tissue using anti-Glucose 6 phosphate isomerasemouse monoclonal antibody.
Immunohistochemistry-Paraffin: Glucose 6 phosphate isomerase Antibody (2D2) [NBP2-02541] - Staining of paraffin-embedded Carcinoma of Human prostate tissue using anti-Glucose 6 phosphate isomerasemouse monoclonal antibody.
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
GNPDA1 Antibody
NBP2-24653
Western Blot: GNPDA1 Antibody [NBP2-24653] - analysis of GNPDA1 in human spleen lysate in the 1) absence and 2) presence of immunizing peptide 3) mouse spleen and 4) rat spleen using GNPDA1 antibody at 1.0 ug/ml, 0.5 ug/ml and 0.5 ug/ml, respectively.
Immunohistochemistry-Paraffin: GNPDA1 Antibody [NBP2-24653] - Formalin-fixed paraffin-embedded human kidney tissue stained with GNPDA1 antibody at 10 ug/ml. Staining of formalin-fixed tissues is enhanced by boiling tissue sections in 10 mM sodium citrate buffer, pH 6.0 for 10-20 min followed by cooling at RT for 20 min.
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
TXNDC15 Antibody
NBP1-89394
Immunocytochemistry/Immunofluorescence: TXNDC15 Antibody [NBP1-89394] - Immunofluorescent staining of human cell line A-431 shows localization to the Golgi apparatus.
Immunohistochemistry-Paraffin: TXNDC15 Antibody [NBP1-89394] - Staining of human colon shows cytoplasmic positivity with a granular pattern in glandular cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
GRP78/HSPA5
Antibody - BSA Free
NBP1-06274
Flow Cytometry: GRP78/HSPA5 Antibody [NBP1-06274] - An intracellular stain was performed on Jurkat cells with Alexa Fluor 647 conjugate of GPR78/HSPA5 antibody NBP1-06274AF647 (blue) and a matched isotype control NBP2-24893AF647 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
Flow Cytometry: GRP78/HSPA5 Antibody [NBP1-06274] - An intracellular stain was performed on HeLa with NBP1-06274 and a matched isotype control. Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Rabbit IgG (H+L) Cross-Adsorbed Secondary Antibody, Dylight 550.
Immunocytochemistry/Immunofluorescence: GRP78/HSPA5 Antibody [NBP1-06274] - NIH-3T3 cells were fixed and permeabilized for 10 minutes using -20C MeOH. The cells were incubated with anti-GRP78/HSPA5 at 2 ug/mL overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
(2 Reviews)
(37 Publications)
Species: Ce, Ch, Dr, Hu, Mu, Rt, Sh, Ze
Applications: Flow, ICC/IF, IHC-FrFl, IHC, IHC-P, Simple Western, WB

Endorepellin/Perlecan/ ...
AF2364
Endorepellin/Perlecan was detected in immersion fixed paraffin-embedded sections of human skin using 5 µg/mL Goat Anti-Human Endorepellin/Perlecan Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2364) overnight at 4 °C. Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(5 Reviews)
(4 Publications)
Species: Hu
Applications: IHC, WB
Protein Disulfide
Isomerase/P4HB Antibo ...
NB300-517
Western Blot: Protein Disulfide Isomerase/P4HB Antibody (RL90) [NB300-517] - Cell surface Protein Disulfide Isomerase/P4HB associated with GC-AC. Proteins were pulled down with anti GC-A antibody from HUVEC or HMC membrane preparations and detected with anti-Protein Disulfide Isomerase/P4HB antibody (RL90)compared to control IP (no anti GC-A) and non-immunoprecipitated proteins from HMC and HUVEC. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0112986), licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: Protein Disulfide Isomerase/P4HB Antibody (RL90) [NB300-517] - Formalin fixed cells were permeabilized with 0.1% Triton X-100 in PBS for 10 minutes at room temperature and blocked with 2% BSA in PBS + 0.1% Triton X-100 for 30 minutes at room temperature. Cells were probed with a Protein Disulfide Isomerase/P4HB monoclonal antibody at a dilution of 1:75 for at least 1 hour at room temperature, washed with PBS, and incubated with Dylight 488 goat anti-mouse IgG secondary antibody at a dilution of 1:250 for 30 minutes at room temperature. Actin was stained with Dylight 350 Phalloidin at a dilution of 1:120 (2.5units/ml final concentration) and nuclei (red) were stained with DRAQ5 at a concentration of 1ug/ml for 30 minutes.
Immunocytochemistry/Immunofluorescence: Protein Disulfide Isomerase/P4HB Antibody (RL90) [NB300-517] - Formalin fixed cells were permeabilized with 0.1% Triton X-100 in PBS for 10 minutes at room temperature and blocked with 2% BSA in PBS + 0.1% Triton X-100 for 30 minutes at room temperature. Cells were probed with a Protein Disulfide Isomerase/P4HB monoclonal antibody at a dilution of 1:75 for at least 1 hour at room temperature, washed with PBS, and incubated with DyLight 550 goat anti-mouse IgG secondary antibody at a dilution of 1:250 for 30 minutes at room temperature. Actin was stained with DyLight 488 Phalloidin at a dilution of 1:300 (1 unit/ml final concentration) for 30 minutes.
(3 Reviews)
(22 Publications)
Species: Bv, Ha, Hu, Pm, Mu, Po, Pm, Rb, Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IM, IP, KD, WB
Tapasin Antibody
NBP1-59071
Western Blot: Tapasin Antibody [NBP1-59071] - analysis of HepG2 tissue lysate at a concentration of 0.5ug/ml.
Immunohistochemistry-Paraffin: Tapasin Antibody [NBP1-59071] - Human Skin Tissue Squamous epithelial cells (Indicated with Arrows), 4-8ug/ml.
Immunocytochemistry/Immunofluorescence: Tapasin Antibody [NBP1-59071] - Human Adult liver Observed Staining: Cytoplasmic Primary Antibody Concentration: 1 : 600 Secondary Antibody: Donkey anti-Rabbit-Cy2/3 Secondary Antibody Concentration: 1 : 200 Magnification: 20X Exposure Time: 0.5 2.0 secProtocol located in Reviews and Data.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
PRRT2 Antibody -
BSA Free
NBP2-82026
Western Blot: PRRT2 Antibody [NBP2-82026] - Analysis of PRRT2 in mouse brain tissue lysate with PRRT2 antibody at 1 ug/ml.
Immunohistochemistry: PRRT2 Antibody [NBP2-82026] - Immunohistochemistry of PRRT2 in rat brain tissue with PRRT2 antibody at 2.5 ug/ml.
Immunocytochemistry/Immunofluorescence: PRRT2 Antibody [NBP2-82026] - Immunofluorescence of PRRT2 in rat brain tissue with PRRT2 antibody at 20 ug/ml.
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
PDIA2 Antibody
NB100-1921
Western Blot: PDIA2 Antibody [NB100-1921] - Normal human brain.
Immunocytochemistry/Immunofluorescence: PDIA2 Antibody [NB100-1921] - PDIA2 staining in Hela cells detected with a Dylight 488 labeled secondary antibody (Green) with Hoechst 33258 nuclear counterstain (Blue).
Immunocytochemistry/Immunofluorescence: PDIA2 Antibody [NB100-1921] - IF Confocal analysis of 3T3 cells using PDIA2 antibody (NB100-1921, 1:5). An Alexa Fluor 488-conjugated Goat to rabbit IgG was used as secondary antibody (green). Actin filaments were labeled with Alexa Fluor 568 phalloidin (red). DAPI was used to stain the cell nuclei (blue).
(2 Reviews)
(6 Publications)
Species: Bv, Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
PADI1 Antibody
NBP2-37761
Immunohistochemistry-Paraffin: PADI1 Antibody [NBP2-37761] - Staining in human esophagus and colon tissues using anti-PADI1 antibody. Corresponding PADI1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: PADI1 Antibody [NBP2-37761] - Staining of human colon shows low expression as expected.
Immunohistochemistry-Paraffin: PADI1 Antibody [NBP2-37761] - Staining of human esophagus shows cytoplasmic and nuclear positivity in squamous epithelial cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
SEC14L2 Antibody
(OTI4H2)
NBP2-01346
Flow Cytometry: SEC14L2 Antibody (4H2) [NBP2-01346] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-SEC14L2 antibody, and then analyzed by flow cytometry.
Western Blot: SEC14L2 Antibody (4H2) [NBP2-01346] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY SEC14L2 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-SEC14L2.
Immunohistochemistry-Paraffin: SEC14L2 Antibody (4H2) [NBP2-01346] - Staining of paraffin-embedded Carcinoma of Human liver tissue using anti-SEC14L2 mouse monoclonal antibody.
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
TAP1 Antibody (3D4)
H00006890-M04
Flow Cytometry: TAP1 Antibody (3D4) [H00006890-M04] - Intracellular flow cytometric analysis of TAP1 antibody H00006890-M04 (orange filled) on interferon gamma treated HCT116 cells. Red dotted line in histogram represents unstained and blue filled line represents isotype control. Flow cytometry image added from a verified customer review.
Immunocytochemistry/Immunofluorescence: TAP1 Antibody (3D4) [H00006890-M04] - Analysis of monoclonal antibody to TAP1 on HeLa cell. Antibody concentration 10 ug/ml
(1 Review)
Species: Hu
Applications: ELISA, Flow, ICC/IF, WB
ERK2 Antibody
(SZ25-01)
NBP2-67360
Flow Cytometry: ERK2 Antibody (SZ25-01) [NBP2-67360] - Analysis of Hela cells with ERK2 antibody at 1/50 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody.
Immunocytochemistry/Immunofluorescence: ERK2 Antibody (SZ25-01) [NBP2-67360] - Staining ERK2 in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: ERK2 Antibody (SZ25-01) [NBP2-67360] - Staining ERK2 in MCF-7 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
(1 Review)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
BMP-3b/GDF-10
Antibody [Unconjugate
AF1543
BMP-3b/GDF-10 Antibody [Unconjugated]
(1 Publication)
Species: Hu
Applications: IHC, WB
VDP p115 Antibody
(3F4)
H00008615-M03
Immunocytochemistry/Immunofluorescence: VDP p115 Antibody (3F4) [H00008615-M03] - Analysis of monoclonal antibody to USO1 on HeLa cell. Antibody concentration 10 ug/ml
Immunohistochemistry-Paraffin: VDP p115 Antibody (3F4) [H00008615-M03] - Analysis of monoclonal antibody to USO1 on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 3 ug/ml
Western Blot: VDP p115 Antibody (3F4) [H00008615-M03] - Analysis of USO1 expression in HeLa (Cat # L013V1).
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Filamin B Antibody
NBP1-90286
Immunocytochemistry/Immunofluorescence: Filamin B Antibody [NBP1-90286] - Staining of human cell line U-2 OS shows localization to plasma membrane and cytosol. Antibody staining is shown in green.
Western Blot: Filamin B Antibody [NBP1-90286] - Analysis in human cell lines A-549 and HEK293 using anti-FLNB antibody. Corresponding FLNB RNA-seq data are presented for the same cell lines. Loading control: anti-HSP90B1.
Immunohistochemistry-Paraffin: Filamin B Antibody [NBP1-90286] - Staining of human colon, placenta, prostate and skeletal muscle using Anti-Filamin B antibody NBP1-90286 (A) shows similar protein distribution across tissues to independent antibody NBP1-90285 (B).
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NXF1 Antibody
NBP1-31649
Immunohistochemistry-Paraffin: NXF1 Antibody [NBP1-31649] - Paraffin-embedded NCIN87 Xenograft, using antibody at 1:100 dilution.
Western Blot: NXF1 Antibody [NBP1-31649] - Sample (30 ug of whole cell lysate) A: Hela B: Molt-4 7. 5% SDS PAGE; antibody diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: NXF1 Antibody [NBP1-31649] - Paraformaldehyde-fixed HeLa, using antibody at 1:200 dilution.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB

Publications for ERp57/PDIA3 Antibody (NBP1-84796)(4)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(2)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for ERp57/PDIA3 Antibody (NBP1-84796) (0)

There are no reviews for ERp57/PDIA3 Antibody (NBP1-84796). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ERp57/PDIA3 Antibody (NBP1-84796) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ERp57/PDIA3 Products

Bioinformatics Tool for ERp57/PDIA3 Antibody (NBP1-84796)

Discover related pathways, diseases and genes to ERp57/PDIA3 Antibody (NBP1-84796). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ERp57/PDIA3 Antibody (NBP1-84796)

Discover more about diseases related to ERp57/PDIA3 Antibody (NBP1-84796).
 

Pathways for ERp57/PDIA3 Antibody (NBP1-84796)

View related products by pathway.

PTMs for ERp57/PDIA3 Antibody (NBP1-84796)

Learn more about PTMs related to ERp57/PDIA3 Antibody (NBP1-84796).
 

Research Areas for ERp57/PDIA3 Antibody (NBP1-84796)

Find related products by research area.

Blogs on ERp57/PDIA3

There are no specific blogs for ERp57/PDIA3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ERp57/PDIA3 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol PDIA3