Home » ERp57/PDIA3 » ERp57/PDIA3 Antibodies » ERp57/PDIA3 Antibody

ERp57/PDIA3 Antibody

 (4 Publications)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: ERp57/PDIA3 Antibody [NBP1-84796] - Analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-PDIA3 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Genetic Strategies: Western Blot: ERp57/PDIA3 Antibody [NBP1-84796] - Analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-PDIA3 antibody. Remaining relative ...read more
Immunocytochemistry/ Immunofluorescence: ERp57/PDIA3 Antibody [NBP1-84796] - Immunofluorescent staining of human cell line U-2 OS shows localization to endoplasmic reticulum.
Immunohistochemistry-Paraffin: ERp57/PDIA3 Antibody [NBP1-84796] - Staining of human skeletal muscle shows low expression as expected.
Western Blot: ERp57/PDIA3 Antibody [NBP1-84796] - Analysis in human cell line SiHa.
Western Blot: ERp57/PDIA3 Antibody [NBP1-84796] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: ERp57/PDIA3 Antibody [NBP1-84796] - Staining of human thyroid gland shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: ERp57/PDIA3 Antibody [NBP1-84796] - Staining in human thyroid gland and skeletal muscle tissues using anti-PDIA3 antibody. Corresponding PDIA3 RNA-seq data are presented for the same ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

    

Order Details

100% Guarantee on every product

ERp57/PDIA3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PTLKIFRDGEEAGAYDGPRTADGIVSHLKKQAGPASVPLRTEEEFKKFISDKDASIVGFFDDSFSEAHSEFLKAASNLRDNYRFAHTNVESLVNEYDDNGEGIILFRPSHLTNKFEDK
Marker
Endoplasmic Reticulum Marker
Specificity
Specificity of human, mouse, rat ERp57/PDIA3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PDIA3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
  • Knockdown Validated
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ERp57/PDIA3 Protein (NBP1-84796PEP)
Publications
Read Publications using
NBP1-84796 in the following applications:

  • WB
    2 publications

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24336167)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ERp57/PDIA3 Antibody

  • Disulfide isomerase ER-60
  • EC 5.3.4.1
  • endoplasmic reticulum P58
  • Endoplasmic reticulum resident protein 57
  • Endoplasmic reticulum resident protein 60
  • ER protein 60
  • ER60
  • ERp57
  • ERp5758 kDa glucose-regulated protein
  • ERp60
  • ERp6058 kDa microsomal protein
  • ERp61
  • glucose regulated protein, 58kDa
  • GRP57
  • GRP58
  • GRP58ER protein 57
  • HsT17083
  • P58
  • PDIA3
  • phospholipase C-alpha
  • PI-PLC
  • protein disulfide isomerase family A, member 3
  • protein disulfide isomerase-associated 3
  • protein disulfide-isomerase A3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

PLC-gamma 1
Antibody (3C2D11)
NBP2-52532
Western Blot: PLC-gamma 1 Antibody (3C2D11) [NBP2-52532] - Analysis using PLCG1 mouse mAb against Hela (1), A431 (2), C6 (3), NIH/3T3 (4), COS7 (5), and HCT116 (6) cell lysate.
Immunohistochemistry-Paraffin: PLC-gamma 1 Antibody (3C2D11) [NBP2-52532] - Analysis of paraffin-embedded bladder cancer tissues using PLCG1 mouse mAb with DAB staining.
Flow Cytometry: PLC-gamma 1 Antibody (3C2D11) [NBP2-52532] - Analysis of Jurkat cells using PLCG1 mouse mAb (green) and negative control (red).
Species: Hu, Rt, Mk
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
Calreticulin
Antibody
NB600-101
Western Blot: Calreticulin Antibody [NB600-101] - Human kidney lysate.
Immunocytochemistry/Immunofluorescence: Calreticulin Antibody [NB600-101] - Immunofluorescence staining of Calreticulin in HCT15 colon cancer cells using NB600-101. Secondary antibody was an Alexa Fluor 488. Photo courtesy of Dr. Birkenkamp Demtroeder, Arhus University Hospital.
Immunohistochemistry-Paraffin: Calreticulin Antibody [NB600-101] - IHC analysis of a formalin fixed and paraffin embedded (FFPE) tissue section of human thyroid gland using 1:50 dilution of Calreticulin antibody. The signal was developed using HRP-DAB based detection method which followed counterstaining of the nuclei with hematoxylin. This representative section shows a strong positivity of Calreticulin in the follicular epithelial cells, wherein the signal was found to be very intense in the perinuclear region of the cells which correlates well with Endoplasmic reticulum localization of this protein. The para-follicular cells, endothelial cells of blood vessels (not the RBCs though) and the loose connective tissue in the section showed a weak cytoplasmic staining. Some staining was observed in the follicles/colloids also which is potentially the secreted form of Calreticulin.
(20 Publications)
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, B/N, DB, EM, ICC/IF, IHC, IHC-P, IP, PA
Calnexin Antibody
NB100-1965
Western Blot: Calnexin Antibody [NB100-1965] - A dilution of 1/2000 used in TBS with 0.05% Tween-20. Bands visualized by ECL using goat anti-rabbit HRP at 1:2000.
Immunocytochemistry/Immunofluorescence: Calnexin Antibody [NB100-1965] - Antibody was tested at 1:50 in HeLa cells with FITC (green). Nuclei and actin were counterstained with DAPI (blue) and Phalloidin (red).
Immunohistochemistry: Calnexin Antibody [NB100-1965] - IHC analysis of CANX in mouse prostate using DAB with hematoxylin counterstain.
(1 Review)
(9 Publications)
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Dr, GP, Rb, Sh, Xp, Ze
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
Glucose 6
phosphate isomerase A ...
NBP2-02541
Western Blot: Glucose 6 phosphate isomerase Antibody (2D2) [NBP2-02541] Analysis of extracts (35ug) from 9 different cell lines by using anti-Glucose 6 phosphate isomerasemonoclonal antibody.
Immunocytochemistry/Immunofluorescence: Glucose 6 phosphate isomerase Antibody (2D2) [NBP2-02541] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY Glucose 6 phosphate isomerase.
Immunohistochemistry-Paraffin: Glucose 6 phosphate isomerase Antibody (2D2) [NBP2-02541] - Staining of paraffin-embedded Human prostate tissue using anti-Glucose 6 phosphate isomerasemouse monoclonal antibody.
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
GNPDA1 Antibody
NBP2-24557
Western Blot: GNPDA1 Antibody [NBP2-24557] - analysis of GNPDA1 in human spleen lysate in the 1) absence and 2) presence of immunizing peptide using this antibody. 25 ug/ml.
Immunohistochemistry-Paraffin: GNPDA1 Antibody [NBP2-24557] - Formalin-fixed paraffin-embedded human kidney tissue stained with GNPDA1 antibody at 10 ug/ml. Staining of formalin-fixed tissues is enhanced by boiling tissue sections in 10 mM sodium citrate buffer, pH 6.0 for 10-20 min followed by cooling at RT for 20 min.
Species: Hu, Eq, Pm
Applications: WB, IHC-P
TXNDC15 Antibody
NBP1-89394
Immunocytochemistry/Immunofluorescence: TXNDC15 Antibody [NBP1-89394] - Immunofluorescent staining of human cell line A-431 shows localization to the Golgi apparatus.
Immunohistochemistry-Paraffin: TXNDC15 Antibody [NBP1-89394] - Staining of human colon shows cytoplasmic positivity with a granular pattern in glandular cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
GRP78/HSPA5
Antibody
NBP1-06274
Western Blot: GRP78/HSPA5 Antibody [NBP1-06274] - Total protein from human HeLa and A431 cells, mouse 3T3 cells and rat PC12 cells was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 1.0 ug/ml anti-GPR78 in blocking buffer and detected with an anti-rabbit HRP secondary antibody using chemiluminescence.
Immunocytochemistry/Immunofluorescence: GRP78/HSPA5 Antibody [NBP1-06274] - NIH-3T3 cells were fixed and permeabilized for 10 minutes using -20C MeOH. The cells were incubated with anti-GRP78/HSPA5 at 2 ug/ml overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Flow Cytometry: GRP78/HSPA5 Antibody [NBP1-06274] - An intracellular stain was performed on HeLa with GRP78/HSPA5 Antibody NBP1-06274 and a matched isotype control. Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Rabbit IgG (H+L) Cross-Adsorbed Secondary Antibody, Dylight 550 (SA5-10033, Thermo Fisher).
(1 Review)
(15 Publications)
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF

Endorepellin/Perlecan/ ...
AF2364
Endorepellin/Perlecan was detected in immersion fixed paraffin-embedded sections of human skin using 5 µg/mL Goat Anti-Human Endorepellin/Perlecan Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2364) overnight at 4 °C. Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(3 Publications)
Species: Hu
Applications: WB, IHC
Protein Disulfide
Isomerase/P4HB Antibo ...
H00005034-B01P
Western Blot: Protein Disulfide Isomerase/P4HB Antibody [H00005034-B01P] - Analysis of P4HB expression in human liver.
Immunocytochemistry/Immunofluorescence: Protein Disulfide Isomerase/P4HB Antibody [H00005034-B01P] - Analysis of purified antibody to P4HB on HeLa cell. (antibody concentration 10 ug/ml)
Western Blot: Protein Disulfide Isomerase/P4HB Antibody [H00005034-B01P] - Analysis of P4HB expression in HeLa.
(1 Review)
(2 Publications)
Species: Hu
Applications: WB, ICC/IF
Tapasin Antibody
NBP1-59071
Western Blot: Tapasin Antibody [NBP1-59071] - Antibody Titration: 1 ug/ml Human liver.
Immunocytochemistry/Immunofluorescence: Tapasin Antibody [NBP1-59071] - Human Adult liver Observed Staining: Cytoplasmic Primary Antibody Concentration: 1 : 600 Secondary Antibody: Donkey anti-Rabbit-Cy2/3 Secondary Antibody Concentration: 1 : 200 Magnification: 20X Exposure Time: 0.5 2.0 secProtocol located in Reviews and Data.
Immunohistochemistry-Paraffin: Tapasin Antibody [NBP1-59071] - Human Skin Tissue Squamous epithelial cells (Indicated with Arrows), 4-8ug/ml.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
PRRT2 Antibody
NBP1-84168
Immunohistochemistry-Paraffin: PRRT2 Antibody [NBP1-84168] - Immunohistochemical staining of human cerebral cortex shows strong positivity in neuropil.
Immunohistochemistry-Paraffin: PRRT2 Antibody [NBP1-84168] - Immunohistochemical staining of human cerebellum shows strong positivity in neuropil.
Immunohistochemistry-Paraffin: PRRT2 Antibody [NBP1-84168] - Immunohistochemical staining of human pancreas shows no positivity as expected.
Species: Hu
Applications: IHC, IHC-P
PDI Antibody (RL90)
NB300-517
Western Blot: PDI Antibody (RL90) [NB300-517] - Analysis of PDI was performed by loading 25 ug of HepG2 (Lane 1), Hela (Lane 2) and NIH-3T3 (Lane 3) cell lysates.
Immunocytochemistry/Immunofluorescence: PDI Antibody (RL90) [NB300-517] - Staining in p19 Cells.
Immunohistochemistry-Paraffin: PDI Antibody (RL90) [NB300-517] - Both normal and cancer biopsies of deparaffinized Human colon tissue tissues.
(3 Reviews)
(18 Publications)
Species: Hu, Mu, Rt, Po, Bv, Ha, Pm, Rb
Applications: WB, B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IM, IP
PADI1 Antibody
NBP2-37761
Immunocytochemistry/Immunofluorescence: PADI1 Antibody [NBP2-37761] - Staining of human cell line HaCaT shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: PADI1 Antibody [NBP2-37761] - Staining of human colon shows low expression as expected.
Immunohistochemistry-Paraffin: PADI1 Antibody [NBP2-37761] - Staining of human esophagus shows cytoplasmic and nuclear positivity in squamous epithelial cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
SEC14L2 Antibody
(OTI4H2)
NBP2-01346
Western Blot: SEC14L2 Antibody (4H2) [NBP2-01346] Analysis of extracts (35ug) from 9 different cell lines by using anti-SEC14L2 monoclonal antibody.
Immunocytochemistry/Immunofluorescence: SEC14L2 Antibody (4H2) [NBP2-01346] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY SEC14L2.
Immunohistochemistry-Paraffin: SEC14L2 Antibody (4H2) [NBP2-01346] - Staining of paraffin-embedded Human prostate tissue using anti-SEC14L2 mouse monoclonal antibody.
Species: Hu, Mu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
TAP1 Antibody
(TAP1.28)
NBP1-54435
Western Blot: TAP1 Antibody (TAP1.28) [NBP1-54435] - Western Blot analysis of TAP1 expression using NBP1-54435 in LCL721 cells
Flow Cytometry: TAP1 Antibody (TAP1.28) [NBP1-54435] - Fow cytometric analysis of TAP1 expression on LCL721 cells. Open histogram indicated the reaction of isotypic control to the cells. Shaded histogram indicated the reaction of NBP1-54435 to the cells.
Immunoprecipitation: TAP1 Antibody (TAP1.28) [NBP1-54435] - Immunoprecipitation of TAP1 from LCL721 celss with (1) NBP1-54435 or (2) mouse IgG. After immunoprecipitated with the antibody, immunocomplex was resolved on SDS-PAGE and immunoblotted with NBP1-54435.
Species: Hu
Applications: WB, Flow, IP
BMP-3b/GDF-10
Antibody [Unconjugate
AF1543
BMP-3b/GDF-10 Antibody [Unconjugated]
(1 Publication)
Species: Hu
Applications: WB, IHC
VDP p115 Antibody
NBP2-38401
Western Blot: VDP p115 Antibody [NBP2-38401] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Immunocytochemistry/Immunofluorescence: VDP p115 Antibody [NBP2-38401] - Immunofluorescent staining of human cell line A-431 shows localization to the Golgi apparatus.
Immunohistochemistry: VDP p115 Antibody [NBP2-38401] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Filamin B Antibody
NBP1-90286
Western Blot: Filamin B Antibody [NBP1-90286] - Analysis in human cell lines A-549 and HEK293 using anti-FLNB antibody. Corresponding FLNB RNA-seq data are presented for the same cell lines. Loading control: anti-HSP90B1.
Immunocytochemistry/Immunofluorescence: Filamin B Antibody [NBP1-90286] - Staining of human cell line U-2 OS shows localization to plasma membrane and cytosol.
Immunohistochemistry-Paraffin: Filamin B Antibody [NBP1-90286] - Staining of human duodenum shows strong membranous and cytoplasmic positivity in glandular cells.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NXF1 Antibody
NBP1-57160
Western Blot: NXF1 Antibody [NBP1-57160] - Lanes: Lane 1 : 7ug HeLa lysate +EGFP SiRNA Lane 2: 7ug HeLa lysate +NXF1 SiRNA Primary, Antibody Dilution: 1 : 300 Secondary Antibody: Anti-rabbit-HRP Secondary, Antibody Dilution: 1 : 500 Gene name: NXF1.
Immunohistochemistry-Paraffin: NXF1 Antibody [NBP1-57160] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.
Western Blot: NXF1 Antibody [NBP1-57160] - HepG2 cell lysate, Antibody Titration: 1.25ug/ml
Species: Hu
Applications: WB, IHC, IHC-P, KD
ERp57/PDIA3
Antibody
NBP1-84796
ERp57/PDIA3 Antibody
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD

Publications for ERp57/PDIA3 Antibody (NBP1-84796)(4)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(2)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for ERp57/PDIA3 Antibody (NBP1-84796) (0)

There are no reviews for ERp57/PDIA3 Antibody (NBP1-84796). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ERp57/PDIA3 Antibody (NBP1-84796) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for ERp57/PDIA3 Antibody (NBP1-84796)

Discover related pathways, diseases and genes to ERp57/PDIA3 Antibody (NBP1-84796). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ERp57/PDIA3 Antibody (NBP1-84796)

Discover more about diseases related to ERp57/PDIA3 Antibody (NBP1-84796).
 

Pathways for ERp57/PDIA3 Antibody (NBP1-84796)

View related products by pathway.

PTMs for ERp57/PDIA3 Antibody (NBP1-84796)

Learn more about PTMs related to ERp57/PDIA3 Antibody (NBP1-84796).
 

Research Areas for ERp57/PDIA3 Antibody (NBP1-84796)

Find related products by research area.

Blogs on ERp57/PDIA3

There are no specific blogs for ERp57/PDIA3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ERp57/PDIA3 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol PDIA3
Entrez