ERp57/PDIA3 Antibody

Images

 
Genetic Strategies: Western Blot: ERp57/PDIA3 Antibody [NBP1-84796] - Analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-PDIA3 antibody. Remaining relative ...read more
Immunocytochemistry/ Immunofluorescence: ERp57/PDIA3 Antibody [NBP1-84796] - Immunofluorescent staining of human cell line U-2 OS shows localization to endoplasmic reticulum.
Immunohistochemistry-Paraffin: ERp57/PDIA3 Antibody [NBP1-84796] - Staining of human skeletal muscle shows low expression as expected.
Western Blot: ERp57/PDIA3 Antibody [NBP1-84796] - Analysis in human cell line SiHa.
Western Blot: ERp57/PDIA3 Antibody [NBP1-84796] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: ERp57/PDIA3 Antibody [NBP1-84796] - Staining of human thyroid gland shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: ERp57/PDIA3 Antibody [NBP1-84796] - Staining in human thyroid gland and skeletal muscle tissues using anti-PDIA3 antibody. Corresponding PDIA3 RNA-seq data are presented for the same ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

   

Order Details

ERp57/PDIA3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PTLKIFRDGEEAGAYDGPRTADGIVSHLKKQAGPASVPLRTEEEFKKFISDKDASIVGFFDDSFSEAHSEFLKAASNLRDNYRFAHTNVESLVNEYDDNGEGIILFRPSHLTNKFEDK
Marker
Endoplasmic Reticulum Marker
Specificity
Specificity of human, mouse, rat ERp57/PDIA3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PDIA3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
  • Knockdown Validated
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ERp57/PDIA3 Protein (NBP1-84796PEP)
Publications
Read Publications using
NBP1-84796 in the following applications:

  • WB
    2 publications

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24336167)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ERp57/PDIA3 Antibody

  • Disulfide isomerase ER-60
  • EC 5.3.4.1
  • endoplasmic reticulum P58
  • Endoplasmic reticulum resident protein 57
  • Endoplasmic reticulum resident protein 60
  • ER protein 60
  • ER60
  • ERp57
  • ERp5758 kDa glucose-regulated protein
  • ERp60
  • ERp6058 kDa microsomal protein
  • ERp61
  • glucose regulated protein, 58kDa
  • GRP57
  • GRP58
  • GRP58ER protein 57
  • HsT17083
  • P58
  • PDIA3
  • phospholipase C-alpha
  • PI-PLC
  • protein disulfide isomerase family A, member 3
  • protein disulfide isomerase-associated 3
  • protein disulfide-isomerase A3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-52532
Species: Hu, Rt, Mk
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, B/N, DB, EM, ICC/IF, IHC, IHC-P, IP, PA
NB100-1965
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Dr, GP, Rb, Sh, Xp, Ze
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24557
Species: Hu, Eq, Pm
Applications: WB, IHC-P
NBP1-89394
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-06274
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
AF2364
Species: Hu
Applications: WB, IHC
H00005034-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-59071
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NB300-517
Species: Hu, Mu, Rt, Po, Bv, Ha, Pm, Rb
Applications: WB, B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IM, IP
NBP2-37761
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-01346
Species: Hu, Mu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-54435
Species: Hu
Applications: WB, Flow, IP
AF1543
Species: Hu
Applications: WB, IHC
NBP2-38401
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90286
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-57160
Species: Hu
Applications: WB, IHC, IHC-P, KD
NBP1-84796
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD

Publications for ERp57/PDIA3 Antibody (NBP1-84796)(4)

Reviews for ERp57/PDIA3 Antibody (NBP1-84796) (0)

There are no reviews for ERp57/PDIA3 Antibody (NBP1-84796). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ERp57/PDIA3 Antibody (NBP1-84796) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for ERp57/PDIA3 Antibody (NBP1-84796)

Discover related pathways, diseases and genes to ERp57/PDIA3 Antibody (NBP1-84796). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ERp57/PDIA3 Antibody (NBP1-84796)

Discover more about diseases related to ERp57/PDIA3 Antibody (NBP1-84796).
 

Pathways for ERp57/PDIA3 Antibody (NBP1-84796)

View related products by pathway.

PTMs for ERp57/PDIA3 Antibody (NBP1-84796)

Learn more about PTMs related to ERp57/PDIA3 Antibody (NBP1-84796).
 

Research Areas for ERp57/PDIA3 Antibody (NBP1-84796)

Find related products by research area.

Blogs on ERp57/PDIA3

There are no specific blogs for ERp57/PDIA3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ERp57/PDIA3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PDIA3
Entrez