HERPUD1 Antibody (2G7)

Images

 
Western Blot: HERPUD1 Antibody (2G7) [H00009709-M04] - Analysis of HERPUD1 expression in HepG2 (Cat # L019V1).
Immunohistochemistry-Paraffin: HERPUD1 Antibody (2G7) [H00009709-M04] - Analysis of monoclonal antibody to HERPUD1 on formalin-fixed paraffin-embedded human tonsil. Antibody concentration 3 ug/ml
Western Blot: HERPUD1 Antibody (2G7) [H00009709-M04] - Analysis of HERPUD1 expression in transfected 293T cell line by HERPUD1 monoclonal antibody (M04), clone 2G7. Lane 1: HERPUD1 transfected lysatE (44 KDa). Lane 2: ...read more
ELISA: HERPUD1 Antibody (2G7) [H00009709-M04] - Detection limit for recombinant GST tagged HERPUD1 is approximately 0.1ng/ml as a capture antibody.
Immunoprecipitation: HERPUD1 Antibody (2G7) [H00009709-M04] - Analysis of HERPUD1 transfected lysate using anti-HERPUD1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with HERPUD1 rabbit polyclonal ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IP
Clone
2G7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

HERPUD1 Antibody (2G7) Summary

Immunogen
HERPUD1 (NP_055500, 74 a.a. ~ 180 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PKQEKRHVLHLVCNVKSPSKMPEINAKVAESTEEPAGSNRGQYPEDSSSDGLRQREVLRNLSSPGWENISRPEAAQQAFQGLGPGFSGYTPYGWLQLSWFQQIYARQ
Specificity
HERPUD1 - homocysteine-inducible, endoplasmic reticulum stress-inducible, ubiquitin-like domain member 1
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
HERPUD1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation
  • Western Blot 1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA.
Publications
Read Publications using H00009709-M04.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HERPUD1 Antibody (2G7)

  • HERPMIF1
  • homocysteine-inducible endoplasmic reticulum stress-inducible ubiquitin-likedomain member 1 protein
  • homocysteine-inducible, endoplasmic reticulum stress-inducible, ubiquitin-likedomain member 1
  • homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domainmember 1 protein
  • KIAA0025MMS-inducible
  • Methyl methanesulfonate (MMF)-inducible fragment protein 1
  • Mif1
  • SUP

Background

The accumulation of unfolded proteins in the endoplasmic reticulum (ER) triggers the ER stress response. This response includes the inhibition of translation to prevent further accumulation of unfolded proteins, the increased expression of proteins involved in polypeptide folding, known as the unfolded protein response (UPR), and the destruction of misfolded proteins by the ER-associated protein degradation (ERAD) system. This gene may play a role in both UPR and ERAD. Its expression is induced by UPR and it has an ER stress response element in its promoter region while the encoded protein has an N-terminal ubiquitin-like domain which may interact with the ERAD system. This protein has been shown to interact with presenilin proteins and to increase the level of amyloid-beta protein following its overexpression. Alternative splicing of this gene produces multiple transcript variants, some encoding different isoforms. The full-length nature of all transcript variants has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for HERPUD1 Antibody (H00009709-M04)(3)

Reviews for HERPUD1 Antibody (H00009709-M04) (0)

There are no reviews for HERPUD1 Antibody (H00009709-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HERPUD1 Antibody (H00009709-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HERPUD1 Antibody (2G7) and receive a gift card or discount.

Bioinformatics

Gene Symbol HERPUD1
Entrez
OMIM
Uniprot