NOD1 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit NOD1 Antibody - BSA Free (NBP2-57631) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NYLKLTYCNACSADCSALSFVLHHFPKRLALDLDNNNLNDYGVRELQPCFSRLTVLRLSVNQITDGGVKVLSE |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
NOD1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
|
| Application Notes |
ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Reactivity Notes
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for NOD1 Antibody - BSA Free
Background
Innate immunity is present in all animals and is the common mode of defense against microorganisms. It detects microorganisms by specific proteins called pattern-recognition molecules (PRMs) (reviewed in Werts et al. 2006). There is a limited set of PRMs in each animal genome, and it has been postulated that the PRMs were evolutionarily selected to detect conserved components or motifs of microorganisms called pathogen-associated molecular patterns (PAMPs). PAMPs are found in a wide range of microorganisms and recognition of PAMPs by PRMs activates inflammatory signaling pathways, thereby stimulating an immune response. NOD (nucleotide-binding oligomerization domain) proteins are a family of cytosolic proteins which have been implicated in innate recognition of bacteria, the induction of inflammatory responses, and the regulation of caspase activation and apoptosis. NOD1/CARD4 (caspase-recruitment domain 4 gene) is a PRM that recognizes specific peptidoglycan (PGN) components of bacterial cell walls (reviewed in Strober et al. 2006, and Inohara et al. 2003). NOD1 is expressed by cell types that are exposed to PGN under physiological conditions including antigen-presenting cells (APCs) such as macrophages and dendritic cells, and epithelial cells (reviewed in Strober et al. 2006). NOD1 is thought to play a role in the pathogenesis of human gastrointestinal disease and is associated with inflammatory bowel diseases and asthma. It is involved in host defense against Helicobacter pylori infection of the gastric mucosa, a chronic infection that can lead to peptic ulcers and gastric cancer. This antibody recognizes NOD1/CARD4. Human NOD1/CARD4 is a 953 amino acid protein.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, KD, KO, PAGE, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Mu, Rb, Rt
Applications: B/N, DB, ELISA, Flow-CS, Flow, Func, ICC/IF, IP, In vitro, WB
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, Simple Western, WB
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, ICFlow, Neut, Simple Western, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IM, IP, KD, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Mu, Rt, Xp, Ye, Ze
Applications: BindInhib, B/N, ELISA, Flow, Func-Inh, IHC, In vitro, In vivo
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-Fr, WB
Species: Hu
Applications: WB
Species: Ca, Eq, Hu, Pm, Mu, Pm, Rt
Applications: B/N, CyTOF-ready, DB, ELISA, Flow-IC, Flow, Func, ICC/IF, IHC, IHC-P, IP, In vitro, KD, Simple Western, WB
Species: Hu, Mu
Applications: Flow, IB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF
Publications for NOD1 Antibody (NBP2-57631) (0)
There are no publications for NOD1 Antibody (NBP2-57631).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for NOD1 Antibody (NBP2-57631) (0)
There are no reviews for NOD1 Antibody (NBP2-57631).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for NOD1 Antibody (NBP2-57631) (0)