NOD1 Antibody - BSA Free

Images

 
Immunocytochemistry/ Immunofluorescence: NOD1 Antibody [NBP2-57631] - Staining of human cell line HaCaT shows localization to mitochondria. Antibody staining is shown in green.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

NOD1 Antibody - BSA Free Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NYLKLTYCNACSADCSALSFVLHHFPKRLALDLDNNNLNDYGVRELQPCFSRLTVLRLSVNQITDGGVKVLSE
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NOD1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NOD1 Recombinant Protein Antigen (NBP2-57631PEP)

Reactivity Notes

Mouse 86%, Rat 88%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for NOD1 Antibody - BSA Free

  • CARD4
  • CARD4NLR family, CARD domain containing 1
  • caspase recruitment domain family, member 4
  • Caspase recruitment domain-containing protein 4
  • CLR7.1
  • NLRC1
  • NOD1
  • nucleotide-binding oligomerization domain containing 1
  • nucleotide-binding oligomerization domain, leucine rich repeat and CARD domaincontaining 1
  • nucleotide-binding oligomerization domain-containing protein 1

Background

Innate immunity is present in all animals and is the common mode of defense against microorganisms. It detects microorganisms by specific proteins called pattern-recognition molecules (PRMs) (reviewed in Werts et al. 2006). There is a limited set of PRMs in each animal genome, and it has been postulated that the PRMs were evolutionarily selected to detect conserved components or motifs of microorganisms called pathogen-associated molecular patterns (PAMPs). PAMPs are found in a wide range of microorganisms and recognition of PAMPs by PRMs activates inflammatory signaling pathways, thereby stimulating an immune response. NOD (nucleotide-binding oligomerization domain) proteins are a family of cytosolic proteins which have been implicated in innate recognition of bacteria, the induction of inflammatory responses, and the regulation of caspase activation and apoptosis. NOD1/CARD4 (caspase-recruitment domain 4 gene) is a PRM that recognizes specific peptidoglycan (PGN) components of bacterial cell walls (reviewed in Strober et al. 2006, and Inohara et al. 2003). NOD1 is expressed by cell types that are exposed to PGN under physiological conditions including antigen-presenting cells (APCs) such as macrophages and dendritic cells, and epithelial cells (reviewed in Strober et al. 2006). NOD1 is thought to play a role in the pathogenesis of human gastrointestinal disease and is associated with inflammatory bowel diseases and asthma. It is involved in host defense against Helicobacter pylori infection of the gastric mucosa, a chronic infection that can lead to peptic ulcers and gastric cancer. This antibody recognizes NOD1/CARD4. Human NOD1/CARD4 is a 953 amino acid protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NB100-56566
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, In vitro, KD, KO, PAGE, Simple Western, WB
H00008767-M02
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NBP1-90044
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-56722
Species: Ca, Hu, Mu, Rb, Rt
Applications: B/N, DB, ELISA, Flow-CS, Flow, Func, ICC/IF, IP, In vitro, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC,  IHC-P, KO, Simple Western, WB
M6000B
Species: Mu
Applications: ELISA
NBP2-12446
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IM, IP, KD, WB
NBP1-86087
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-29328
Species: Bv, Hu, Mu, Rt, Xp, Ye, Ze
Applications: BindInhib, B/N, ELISA, Flow, Func-Inh, IHC, In vitro, In vivo
NBP1-54899
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-Fr, WB
MAB868
Species: Hu
Applications: WB
NBP2-24729
Species: Ca, Eq, Hu, Pm, Mu, Pm, Rt
Applications: B/N, CyTOF-ready, DB, ELISA, Flow-IC, Flow, Func, ICC/IF, IHC,  IHC-P, IP, In vitro, KD, Simple Western, WB
NBP1-78979
Species: Hu, Mu
Applications: Flow, IB, ICC/IF, IHC,  IHC-P
DCP00
Species: Hu
Applications: ELISA
NB100-56565
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP2-01860
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB

Publications for NOD1 Antibody (NBP2-57631) (0)

There are no publications for NOD1 Antibody (NBP2-57631).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NOD1 Antibody (NBP2-57631) (0)

There are no reviews for NOD1 Antibody (NBP2-57631). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for NOD1 Antibody (NBP2-57631) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NOD1 Products

Research Areas for NOD1 Antibody (NBP2-57631)

Find related products by research area.

Blogs on NOD1.


  Read full blog post.

cIAP2 - balancing cell death and cell survival
The inhibitor of apoptosis proteins (IAPs) are important regulators of cell death and inflammation. The cellular inhibitor of apoptosis protein 2 (cIAP2) contains three Baculovirus IAP repeat (BIR) domains, a Ubiquitin associated (UBA) domain, and ...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NOD1 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol NOD1