NLRP1/NALP1 Antibody


Western Blot: NLRP1/NALP1 Antibody [NBP1-54899] - Human Fetal Brain, Antibody Dilution: 1.0 ug/ml.
Western Blot: NLRP1/NALP1 Antibody [NBP1-54899] - NCI-H226 cell lysate, concentration 0.2-1 ug/ml.
Western Blot: NLRP1/NALP1 Antibody [NBP1-54899] - Human Fetal Brain.

Product Details

Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-Fr

Order Details

NLRP1/NALP1 Antibody Summary

Synthetic peptides corresponding to NLRP1(NLR family, pyrin domain containing 1) The peptide sequence was selected from the N terminal of NLRP1 (NP_001028225). DTQEPRIVILQGAAGIGKSTLARQVKEAWGRGQLYGDRFQHVFYFSCREL.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.2-1 ug/ml
  • Immunocytochemistry/Immunofluorescence 1:10-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Frozen 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against NLRP1 and was validated on Western blot. Use in Immunocytochemistry/immunofluorescence and Immunohistochemistry-Frozen reported in scientific literature (PMID 24008734)
Theoretical MW
155 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Read Publications using
NBP1-54899 in the following applications:

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 28164443).

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for NLRP1/NALP1 Antibody

  • CARD7
  • Caspase recruitment domain-containing protein 7
  • CLR17.1
  • Death effector filament-forming ced-4-like apoptosis protein
  • DKFZp586O1822
  • NACHT, leucine rich repeat and PYD (pyrin domain) containing 1
  • NACHT, leucine rich repeat and PYD containing 1
  • NACHT, LRR and PYD containing protein 1
  • NACHT, LRR and PYD domains-containing protein 1
  • NACPP1044
  • NALP1
  • NALP1caspase recruitment domain protein 7
  • NLR family, pyrin domain containing 1
  • NLRP1
  • Nucleotide-binding domain and caspase recruitment domain
  • nucleotide-binding oligomerization domain, leucine rich repeat and pyrin domaincontaining 1
  • PP1044
  • SLEV1
  • VAMAS1


This gene encodes a member of the Ced-4 family of apoptosis proteins. Ced-family members contain a caspase recruitment domain (CARD) and are known to be key mediators of programmed cell death. The encoded protein contains a distinct N-terminal pyrin-like


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, KO
Species: Hu, Rb
Applications: WB, Flow, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
Species: Hu
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, Flow-IC
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Dr, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, Flow-IC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, IHC, ICC

Publications for NLRP1/NALP1 Antibody (NBP1-54899)(5)

Reviews for NLRP1/NALP1 Antibody (NBP1-54899) (0)

There are no reviews for NLRP1/NALP1 Antibody (NBP1-54899). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NLRP1/NALP1 Antibody (NBP1-54899) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for NLRP1/NALP1 Antibody (NBP1-54899)

Discover related pathways, diseases and genes to NLRP1/NALP1 Antibody (NBP1-54899). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NLRP1/NALP1 Antibody (NBP1-54899)

Discover more about diseases related to NLRP1/NALP1 Antibody (NBP1-54899).

Pathways for NLRP1/NALP1 Antibody (NBP1-54899)

View related products by pathway.

PTMs for NLRP1/NALP1 Antibody (NBP1-54899)

Learn more about PTMs related to NLRP1/NALP1 Antibody (NBP1-54899).

Research Areas for NLRP1/NALP1 Antibody (NBP1-54899)

Find related products by research area.

Blogs on NLRP1/NALP1

There are no specific blogs for NLRP1/NALP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our NLRP1/NALP1 Antibody and receive a gift card or discount.


Gene Symbol NLRP1