NLRP1/NALP1 Antibody

Images

 
Western Blot: NLRP1/NALP1 Antibody [NBP1-54899] - Human Fetal Brain, Antibody Dilution: 1.0 ug/ml.
Western Blot: NLRP1/NALP1 Antibody [NBP1-54899] - NCI-H226 cell lysate, concentration 0.2-1 ug/ml.
Western Blot: NLRP1/NALP1 Antibody [NBP1-54899] - Human Fetal Brain.

Product Details

Summary
Reactivity Hu, Mu, Rt, Po, Bv, Ca, Eq, GP, RbSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-Fr
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NLRP1/NALP1 Antibody Summary

Immunogen
Synthetic peptides corresponding to NLRP1(NLR family, pyrin domain containing 1) The peptide sequence was selected from the N terminal of NLRP1 (NP_001028225). DTQEPRIVILQGAAGIGKSTLARQVKEAWGRGQLYGDRFQHVFYFSCREL.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NLRP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
  • Immunocytochemistry/Immunofluorescence 1:10-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Frozen 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against NLRP1 and was validated on Western blot. Use in Immunocytochemistry/immunofluorescence and Immunohistochemistry-Frozen reported in scientific literature (PMID 24008734)
Theoretical MW
155 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publications using
NBP1-54899 in the following applications:

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 28164443).

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for NLRP1/NALP1 Antibody

  • CARD7
  • CARD7SLEV1
  • Caspase recruitment domain-containing protein 7
  • CLR17.1
  • Death effector filament-forming ced-4-like apoptosis protein
  • DEFCAP
  • DEFCAPVAMAS1
  • DKFZp586O1822
  • KIAA0926DEFCAP-L/S
  • NACHT, leucine rich repeat and PYD (pyrin domain) containing 1
  • NACHT, leucine rich repeat and PYD containing 1
  • NACHT, LRR and PYD containing protein 1
  • NACHT, LRR and PYD domains-containing protein 1
  • NACPP1044
  • NALP1
  • NALP1caspase recruitment domain protein 7
  • NLR family, pyrin domain containing 1
  • NLRP1
  • Nucleotide-binding domain and caspase recruitment domain
  • nucleotide-binding oligomerization domain, leucine rich repeat and pyrin domaincontaining 1
  • PP1044
  • SLEV1
  • VAMAS1

Background

This gene encodes a member of the Ced-4 family of apoptosis proteins. Ced-family members contain a caspase recruitment domain (CARD) and are known to be key mediators of programmed cell death. The encoded protein contains a distinct N-terminal pyrin-like

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, Ch, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, HEStain, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, KO
NBP2-67360
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-56583
Species: Hu, Rb
Applications: WB, Flow, IHC, IHC-P, KO
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-67471
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13245
Species: Hu
Applications: IHC, IHC-P
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
7270-IL/CF
Species: Hu
NB100-56599
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, Flow-IC
NB100-56098
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP
NB100-56503
Species: Hu, Mu, Rt, Dr, Rb
Applications: WB, Simple Western, Flow, IB, ICC/IF, IHC, IHC-P, Flow-CS, Flow-IC
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, In vitro
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
NBP2-12446
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IM
AF3667
Species: Hu, Mu
Applications: WB, Simple Western, IHC, ICC
NBP1-54899
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, GP, Rb
Applications: WB, ICC/IF, IHC, IHC-Fr

Publications for NLRP1/NALP1 Antibody (NBP1-54899)(7)

We have publications tested in 2 confirmed species: Mouse, Rat.

We have publications tested in 4 applications: ICC/IF, IHC, IHC-Fr, WB.


Filter By Application
ICC/IF
(1)
IHC
(2)
IHC-Fr
(1)
WB
(4)
All Applications
Filter By Species
Mouse
(4)
Rat
(1)
All Species
Showing Publications 1 - 7 of 7.
Publications using NBP1-54899 Applications Species
Mousavi M, Hedayatpour A, Mortezaee K et al. Schwann cell transplantation exerts neuroprotective roles in rat model of spinal cord injury by combating inflammasome activation and improving motor recovery and remyelination Metab Brain Dis Jun 4 2019 [PMID: 31165391]
Chen K, Fan J, Luo ZF et al. Reduction of SIRT1 epigenetically upregulates NALP1 expression and contributes to neuropathic pain induced by chemotherapeutic drug bortezomib J Neuroinflammation Oct 20 2018 [PMID: 30342528] (IHC, Rat, Mouse) IHC Rat, Mouse
Lee HI, Lee SW, Kim NG et al. Low-level light emitting diode (LED) therapy suppresses inflammasome-mediated brain damage in experimental ischemic stroke. J Biophotonics. 2017 Feb 06 [PMID: 28164443] (WB, Mouse) WB Mouse
Tan CC, Zhang JG, Tan MS et al. NLRP1 inflammasome is activated in patients with medial temporal lobe epilepsy and contributes to neuronal pyroptosis in amygdala kindling-induced rat model J Neuroinflammation. 2015 Jan 28 [PMID: 25626361] (WB, IHC) WB, IHC
Fann DY, Santro T, Manzanero S et al. Intermittent fasting attenuates inflammasome activity in ischemic stroke. Exp. Neurol. 2014 May 05 [PMID: 24805069] (WB, Mouse) WB Mouse
Yang-Wei Fann D, Lee SY et al. Intravenous immunoglobulin suppresses NLRP1 and NLRP3 inflammasome-mediated neuronal death in ischemic stroke. Cell Death Dis. 2013 Sep 5 [PMID: 24008734] (WB, ICC/IF, IHC-Fr, Mouse) WB, ICC/IF, IHC-Fr Mouse
Fahy,RJ. Am. J. Respir. Crit. Care Med. 177 (9), 983-988. 2008 [PMID: 18263805]

Reviews for NLRP1/NALP1 Antibody (NBP1-54899) (0)

There are no reviews for NLRP1/NALP1 Antibody (NBP1-54899). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NLRP1/NALP1 Antibody (NBP1-54899) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional NLRP1/NALP1 Products

Bioinformatics Tool for NLRP1/NALP1 Antibody (NBP1-54899)

Discover related pathways, diseases and genes to NLRP1/NALP1 Antibody (NBP1-54899). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NLRP1/NALP1 Antibody (NBP1-54899)

Discover more about diseases related to NLRP1/NALP1 Antibody (NBP1-54899).
 

Pathways for NLRP1/NALP1 Antibody (NBP1-54899)

View related products by pathway.

PTMs for NLRP1/NALP1 Antibody (NBP1-54899)

Learn more about PTMs related to NLRP1/NALP1 Antibody (NBP1-54899).
 

Research Areas for NLRP1/NALP1 Antibody (NBP1-54899)

Find related products by research area.

Blogs on NLRP1/NALP1

There are no specific blogs for NLRP1/NALP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NLRP1/NALP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NLRP1
Entrez
Uniprot