RIPK2 Antibody (6F7)

Images

 
Western Blot: RIPK2 Antibody (6F7) [H00008767-M02] - RIPK2 monoclonal antibody (M02), clone 6F7. Analysis of RIPK2 expression in NIH/3T3.
Immunohistochemistry-Paraffin: RIPK2 Antibody (6F7) [H00008767-M02] - Analysis of monoclonal antibody to RIPK2 on formalin-fixed paraffin-embedded human prostate. Antibody concentration 1.2 ug/ml.
Western Blot: RIPK2 Antibody (6F7) [H00008767-M02] - RIPK2 monoclonal antibody (M02), clone 6F7 Analysis of RIPK2 expression in HeLa.
Western Blot: RIPK2 Antibody (6F7) [H00008767-M02] - RIPK2 monoclonal antibody (M02), clone 6F7. Analysis of RIPK2 expression in PC-12.
Western Blot: RIPK2 Antibody (6F7) [H00008767-M02] - RIPK2 monoclonal antibody (M02), clone 6F7. Analysis of RIPK2 expression in Raw 264.7.
Western Blot: RIPK2 Antibody (6F7) [H00008767-M02] - Analysis of RIPK2 expression in transfected 293T cell line by RIPK2 monoclonal antibody (M02), clone 6F7.Lane 1: RIPK2 transfected lysate(61.2 KDa).Lane 2: ...read more
ELISA: RIPK2 Antibody (6F7) [H00008767-M02] - Detection limit for recombinant GST tagged RIPK2 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, IHC-P
Clone
6F7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

RIPK2 Antibody (6F7) Summary

Immunogen
RIPK2 (AAH04553 431 a.a. - 540 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LQPGIAQQWIQSKREDIVNQMTEACLNQSLDALLSRDLIMKEDYELVSTKPTRTSKVRQLLDTTDIQGEEFAKVIVQKLKDNKQMGLQPYPEILVVSRSPSLNLLQNKSM
Specificity
RIPK2 (6F7)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RIPK2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB.
Control
RIPK2 Lysate (NBP2-64924)
Publications
Read Publications using H00008767-M02.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Mouse-On-Mouse blocking reagent may be needed for IHC and ICC experiments to reduce high background signal. You can find these reagents under catalog numbers PK-2200-NB and MP-2400-NB. Please contact Technical Support if you have any questions.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RIPK2 Antibody (6F7)

  • CARD3
  • CARD-containing IL-1 beta ICE-kinase
  • CARD-containing interleukin-1 beta-converting enzyme (ICE)-associated kinase
  • CARD-containing interleukin-1 beta-converting enzyme-associated kinase
  • CARDIAKCCK
  • EC 2.7.11
  • EC 2.7.11.1
  • growth-inhibiting gene 30
  • receptor interacting protein 2
  • receptor-interacting protein (RIP)-like interacting caspase-like apoptosisregulatory protein (CLARP) kinase
  • Receptor-interacting protein 2
  • receptor-interacting serine/threonine-protein kinase 2
  • receptor-interacting serine-threonine kinase 2
  • RICKGIG30
  • RIP-2
  • RIP2CARD-carrying kinase
  • RIP-like-interacting CLARP kinase

Background

This gene encodes a member of the receptor-interacting protein (RIP) family of serine/threonine protein kinases. The encoded protein contains a C-terminal caspase activation and recruitment domain (CARD), and is a component of signaling complexes in both the innate and adaptive immune pathways. It is a potent activator of NF-kappaB and inducer of apoptosis in response to various stimuli.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2803
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
AF2680
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-37447
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, IF
NBP1-05163
Species: Hu, Rt, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-48988
Species: Hu
Applications: IHC, IHC-P
NLS830
Species: Hu, Po, Bt, Ca, Eq, Mk, Pm, Rb
Applications: WB, IHC, IHC-P
NB100-1793
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
NBP2-33903
Species: Hu
Applications: IHC, IHC-P
NBP1-80865
Species: Hu
Applications: IHC, IHC-P
NB300-187
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
MAB1249
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
AF4499
Species: Hu, Mu, Rt
Applications: WB, Simple Western
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00008767-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P

Publications for RIPK2 Antibody (H00008767-M02)(2)

Reviews for RIPK2 Antibody (H00008767-M02) (0)

There are no reviews for RIPK2 Antibody (H00008767-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RIPK2 Antibody (H00008767-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for RIPK2 Antibody (H00008767-M02)

Discover related pathways, diseases and genes to RIPK2 Antibody (H00008767-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RIPK2 Antibody (H00008767-M02)

Discover more about diseases related to RIPK2 Antibody (H00008767-M02).
 

Pathways for RIPK2 Antibody (H00008767-M02)

View related products by pathway.

PTMs for RIPK2 Antibody (H00008767-M02)

Learn more about PTMs related to RIPK2 Antibody (H00008767-M02).
 

Research Areas for RIPK2 Antibody (H00008767-M02)

Find related products by research area.

Blogs on RIPK2

There are no specific blogs for RIPK2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RIPK2 Antibody (6F7) and receive a gift card or discount.

Bioinformatics

Gene Symbol RIPK2
Entrez
OMIM
Uniprot