DPEP1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: DPEP1 Antibody [NBP1-86087] - Staining human cell line Hep G2 shows positivity in nucleus and cell junctions. Antibody staining is shown in green.

Immunohistochemistry analysis in human small intestine and liver tissues using HPA012783 antibody. Corresponding DPEP1 RNA-seq data are presented for the same tissues.

Staining of human liver shows no positivity in hepatocytes as expected.

Staining of human small intestine shows strong positivity in apical membrane in glandular cells.

Staining of human kidney, liver, small intestine and testis using Anti-DPEP1 antibody NBP1-86087 (A) shows similar protein distribution across tissues to independent antibody NBP1-86115 (B).

Staining of human testis shows strong membranous positivity in Leydig cells.

Staining of human kidney shows strong membranous and cytoplasmic positivity in cells in tubules.

Analysis in control (vector only transfected HEK293T lysate) and DPEP1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DPEP1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SLIGVEGGHSIDSSLGVLRALYQLGMRYLTLTHSCNTPWADNWLVDTGDSEPQSQGLSPFGQRVVKELNRLGVLIDLAHVSVATMKATLQLSRAPVIFSHSSAYSVCASRRN
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DPEP1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  DPEP1 Protein (NBP1-86087PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (80%), Rat (82%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for DPEP1 Antibody - BSA Free

• dehydropeptidase-I
• dipeptidase 1 (renal)
• dipeptidase 1
• DPEP1
• EC 3.4.13.19
• HRDP
• MDPMBD1
• Microsomal Dipeptidase
• RDPMicrosomal dipeptidase
• Renal Dipeptidase

Background

DPEP1 (EC 3.4.13.11) is a kidney membrane enzyme that hydrolyzes a variety of dipeptides and is implicated in renalmetabolism of glutathione and its conjugates, e.g., leukotriene D4 (Kozak and Tate, 1982 (PubMed 6122685)). DPEP1 isresponsible for hydrolysis of the beta-lactam ring of antibiotics, such as penem and carbapenem (Campbell et al., 1984(PubMed 6334084)). Earlier, beta-lactamase enzymes were thought to occur only in bacteria, where their probablefunction was in protecting the organisms against the action of beta-lactam antibiotics. These antibiotics exhibitselective toxicity against bacteria but virtual inertness against many eukaryotic cells (Adachi et al., 1990 (PubMed2303490)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for DPEP1 Antibody (NBP1-86087)(1)

Publication using NBP1-86087

• Okamoto T, Matsumura N, Mandai M et al. Distinguishing primary from secondary mucinous ovarian tumors: an algorithm using the novel marker DPEP1. Mod Pathol. 2011-02-01 [PMID: 21076463]

Bioinformatics

• Gene Symbol: DPEP1
• Entrez:
  • 1800(Human)