ATN1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ATN1 Antibody [NBP1-90044] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: ATN1 Antibody [NBP1-90044] - Staining of human placenta shows strong nuclear positivity in trophoblastic cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ATN1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:HPYAMSPSLGSLRPYPPGPAHLPPPHSQVSYSQAGPNGPPVSSSSNSSSSTSQGSYPCSHPSPSQGPQGAPYPFPPVPTVTTSSATLSTVIATVASSPAGYKTASPPGPPPYGKRAPSPGAYKTATPPGYKPGSPPSFRTGTPPGY
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATN1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Positive Control
Brain Frontal Lobe Lysate (NB820-59378)
Control Peptide
ATN1 Protein (NBP1-90044PEP)
Publications
Read Publication using
NBP1-90044 in the following applications:

  • WB
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25519973).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ATN1 Antibody

  • ATN1
  • atrophin 1
  • atrophin-1
  • B37
  • D12S755E
  • dentatorubral-pallidoluysian atrophy (atrophin-1)
  • Dentatorubral-pallidoluysian atrophy protein
  • DRPLA
  • DRPLANOD
  • HRS
  • NOD

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
NBP1-33284
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32083
Species: Hu
Applications: WB, ICC/IF
AF2086
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP1-90044
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for ATN1 Antibody (NBP1-90044)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for ATN1 Antibody (NBP1-90044) (0)

There are no reviews for ATN1 Antibody (NBP1-90044). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ATN1 Antibody (NBP1-90044) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional ATN1 Products

Bioinformatics Tool for ATN1 Antibody (NBP1-90044)

Discover related pathways, diseases and genes to ATN1 Antibody (NBP1-90044). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATN1 Antibody (NBP1-90044)

Discover more about diseases related to ATN1 Antibody (NBP1-90044).
 

Pathways for ATN1 Antibody (NBP1-90044)

View related products by pathway.

PTMs for ATN1 Antibody (NBP1-90044)

Learn more about PTMs related to ATN1 Antibody (NBP1-90044).
 

Research Areas for ATN1 Antibody (NBP1-90044)

Find related products by research area.

Blogs on ATN1

There are no specific blogs for ATN1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATN1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ATN1
Entrez