LC3A Antibody - BSA Free

Images

 
Western Blot: LC3A Antibody - BSA Free [NB100-2331] - LC3A Antibody [NB100-2331] - High autophagosome concentration is consumed during early immortalized human mesenchymal stem cell differentiation. Immortalized human ...read more
Immunocytochemistry/ Immunofluorescence: LC3A Antibody - BSA Free [NB100-2331] - LC3A Antibody [NB100-2331] - Analysis in PFA fixed NIH/3T3 cells using anti-LC3A antibody. Image from verified customer review.
Immunohistochemistry: LC3A Antibody - BSA Free [NB100-2331] - LC3A Antibody [NB100-2331] - Staining in mouse meniscus and cartilage. Image from verified customer review.
Western Blot: LC3A Antibody - BSA Free [NB100-2331] - Autophagy mobilized during differentiation of immortalized human mesenchymal stem cells (ihMSCs). Cultured ihMSCs were stimulated to undergo osteogenesis to form ...read more
Western Blot: LC3A Antibody - BSA Free [NB100-2331] - LC3A Antibody [NB100-2331] - Autophagy mobilized during differentiation of immortalized human mesenchymal stem cells (ihMSCs). Cultured ihMSCs were stimulated to ...read more
Western Blot: LC3A Antibody - BSA Free [NB100-2331] - LC3A Antibody [NB100-2331] - This LC3A antibody Image shows Analysis in human cell lysates.
Western Blot: LC3A Antibody - BSA Free [NB100-2331] - LC3A Antibody [NB100-2331] - This LC3A antibody Image shows analysis of heart tissue lysates from mice which were subjected or not to 48 hours of starvation. The ...read more
Western Blot: LC3A Antibody - BSA Free [NB100-2331] - LC3A Antibody [NB100-2331] - Detection of HRP conjugated autophagic LC3 in mouse ES cell lysate. The atg5-/- lane (ES cells, cultured to form embryonic bodies, that ...read more
Immunocytochemistry/ Immunofluorescence: LC3A Antibody - BSA Free [NB100-2331] - LC3A Antibody [NB100-2331] - This LC3A antibody Image shows an analysis in HeLa cells using anti-LC3 antibody (red). Nuclei were ...read more
Immunocytochemistry/ Immunofluorescence: LC3A Antibody - BSA Free [NB100-2331] - LC3A Antibody [NB100-2331] - Left panel shows untreated HeLa cells. Right panel shows HeLa cells that were treated with 50 uM CQ ...read more
Immunohistochemistry: LC3A Antibody - BSA Free [NB100-2331] - LC3A Antibody [NB100-2331] - Rapamycin increases autophagy in brains of PDAPP mice. Representative epifluorescent (c200x) image of hippocampal CA1 in ...read more
Immunohistochemistry: LC3A Antibody - BSA Free [NB100-2331] - LC3A Antibody [NB100-2331] - Analysis in mouse renal tissue. Image from verifed customer review.
Simple Western: LC3A Antibody - BSA Free [NB100-2331] - LC3A Antibody [NB100-2331] - Image shows a specific band for LC3 in 0.5 mg/mL of Neuro2A lysate. This experiment was performed under reducing conditions using the ...read more
Western Blot: LC3A Antibody - BSA Free [NB100-2331] - Chronic, third window RIC increases the expression of autophagosome proteins, LC3I/II & Atg5.(A) Western blots for autophagy related signaling proteins. (B) ...read more
Western Blot: LC3A Antibody - BSA Free [NB100-2331] - Optn or p62 deficiency affects autophagosome formation.(A) Workflow of the experiments shown in (B-G). Larvae were treated with 100 nM of Baf A1 for 12 h from 3.5 ...read more
Western Blot: LC3A Antibody - BSA Free [NB100-2331] - UBC9 is degraded by autophagy in epithelial cells.(A) Immunolocalization of UBC9 in ultrathin sections of HKs transduced with empty or HPV16 E6/E7 vectors. Original ...read more
Western Blot: LC3A Antibody - BSA Free [NB100-2331] - Dram1 is required for GFP-Lc3 targeting to Mm clusters.a, b Representative confocal micrographs & quantification of GFP-Lc3 puncta in dram1∆19n/∆19n & dram1+/+ ...read more
Western Blot: LC3A Antibody - BSA Free [NB100-2331] - Knockdown of FUT1 is associated with an increase in autophagic flux. (a) Immunoblot analysis of LC3-II & p62 levels in control & FUT1 knockdown cells. Total cell ...read more
Western Blot: LC3A Antibody - BSA Free [NB100-2331] - Effect of MIR376A overexpression on autophagy.(A) MCF-7 cells were co-transfected with either MIR-CNT (control plasmid) or MIR376A & GFP-LC3 plasmid, & GFP-LC3 dot ...read more
Western Blot: LC3A Antibody - BSA Free [NB100-2331] - Tau clearance in vivo & autophagy function. Clearance kinetics of photoconverted Dendra-tau measured in neurons of WT-tau & AT152T-tau fish. Measurement of intensity ...read more

Product Details

Summary
Reactivity Hu, Mu, Rt, Am, Ca, Fi, Pl, Ze, BvSpecies Glossary
Applications WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IP, NULL, WB, ChIP, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free
Concentration
1.0 mg/ml

Order Details

LC3A Antibody - BSA Free Summary

Description
Novus Biologicals Rabbit LC3A Antibody - BSA Free (NB100-2331) is a polyclonal antibody validated for use in IHC, WB, ELISA, Flow, ICC/IF, Simple Western, IP and ChIP. Anti-LC3A Antibody: Cited in 306 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This LC3A Antibody was prepared from a synthetic peptide made to an internal portion of the human LC3 protein sequence (between residues 25-121). [Uniprot: Q9H492].
Localization
LC3-I is cytoplasmic. LC3-II binds to the autophagic membranes.
Marker
Autophagosome Marker
Specificity
This LC3A Antibody detects both LC3A and LC3B.
Predicted Species
Bovine (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MAP1LC3A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Chromatin Immunoprecipitation (ChIP)
  • Chromatin Immunoprecipitation reported in scientific literature (PMID 33035707)
  • ELISA reported in scientific literature (PMID 20930550)
  • Flow Cytometry reported in scientific literature (PMID 24419333)
  • Immunoblotting reported in scientific literature (PMID 28253371)
  • Immunocytochemistry/ Immunofluorescence 1:100-1:300. Use reported in scientific literature (PMID 21545732)
  • Immunohistochemistry Whole-Mount reported in scientific literature (PMID 31783118)
  • Immunohistochemistry 1:200-1:400
  • Immunohistochemistry-Frozen
  • Immunohistochemistry-Paraffin 1:200-1:400. Use reported in scientific literature (PMID 26571030)
  • Immunoprecipitation 20 ug / 500 ug of lysate
  • Simple Western 1:50
  • Southern Blot
  • Western Blot 2.0 ug/ml
Application Notes
Western blot bands are seen at ~19 kDa, representing LC3-I, and ~17 kDa, representing LC3-II. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. Use in Southern blot reported in scientific literature (PMID: 21262964). In ICC, cytoplasmic staining was observed in HeLa cells. In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
See Simple Western Antibody Database for Simple Western validation: Tested in Neuro2A lysate 0.5 mg/mL, separated by Size, antibody dilution of 1:50, apparent MW was 16 kDa
Control
Mouse Brain Whole Tissue Lysate (Adult Whole Normal)
Human Brain Whole Tissue Lysate (Adult Whole Normal)
Neuro2a Whole Cell Lysate
Neuro2a Chloroquine Treated / Untreated Cell Lysate
HeLa Chloroquine Treated / Untreated Cell Lysate
Reviewed Applications
Read 22 Reviews rated 4.3
using
NB100-2331 in the following applications:

Publications
Read Publications using
NB100-2331 in the following applications:

Reactivity Notes

Use in Rat reported in scientific literature (PMID:33678798). Use in Amphibian reported in scientific literature (PMID:29777142).

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS
Preservative
0.02% Sodium Azide
Concentration
1.0 mg/ml
Purity
Immunogen affinity purified

Alternate Names for LC3A Antibody - BSA Free

  • Apg8
  • APG8a
  • Apg8p3
  • ATG8E
  • Autophagy-related protein LC3 A
  • Autophagy-related ubiquitin-like modifier LC3 A
  • LC3
  • LC3A
  • MAP1 light chain 3-like protein 1
  • MAP1A/1B light chain 3 A
  • MAP1A/MAP1B LC3 A
  • MAP1A/MAP1B light chain 3 A
  • MAP1ALC3
  • MAP1BLC3
  • MAP1LC3A
  • Microtubule-associated protein 1 light chain 3 alpha
  • microtubule-associated proteins 1A/1B light chain 3
  • microtubule-associated proteins 1A/1B light chain 3A
  • MLP3A

Background

Human Microtubule-associated Protein 1A/1B Light Chain 3A (MAP1LC3A), also called LC3A for short, is a 121 amino acid (aa) protein with a theoretic molecular weight of ~14 kDa. LC3A belongs to the LC3 subfamily of Autophagy-related 8 (Atg8) proteins, which also includes LC3B and LC3C (1). The process of autophagy is the bulk degradation of proteins and organelles. Whether these three proteins have distinct roles in autophagy remains unclear, but they do have unique subcellular expression (2). Specifically, LC3A shows perinuclear and nuclear localization (2). The Atg8 family members share a similar structure of two amino-terminal alpha-helices and a ubiquitin-like core but are unique in aa sequence (1). LC3 utilizes a ubiquitin-like conjugation system to covalently bind to phosphatidylethanolamine (PE), also called lipidation, which is mediated by a series of steps (1, 3). Briefly, unprocessed, cytosolic LC3 (pro-LC3) is cleaved by the cysteine protease Atg4 to expose a c-terminal glycine (Gly) residue (LC3-I); the Gly is activated by E1-like enzyme Atg7, transferred to E2-like enzyme Atg3, and an E3-like complex facilitates the conjugation of LC3 with PE (LC3-II), incorporating it into the phagophore membrane during autophagosome formation (1, 3). The recruitment of LC3 to the phagophore is thought to mediate membrane elongation and closure (1, 3). Additionally, LC3 plays a role in recruiting cargo (protein aggregates, pathogens, and organelles) to autophagosomes and delivery for lysosomal degradation (1).

The process of autophagy is associated with a variety of diseases including neurodegenerative diseases, neuromuscular, tumorigenesis, and viral and bacterial infections (4). LC3 is a useful marker of autophagy in both healthy and diseased cells (4). Interestingly, LC3A has two variants (v1 and v2) which differ in N-terminal sequence due to the varying transcriptional start sites (5). One particular study found that LC3Av1, but not v2 or LC3B, was silenced in various cancer cell lines due to aberrant DNA methylation and re-expression of LC3Av1 in LC3Av1-silenced cells inhibited tumor growth, where overall findings suggest a possible tumor-suppressive role (5).

Alternative names for LC3A include Apg8, APG8a, ATG8E, Autophagy-related protein LC3 A, Autophagy-related ubiquitin-like modifier LC3 A, MAP1A/1B light chain 3 A, microtubule-associated proteins 1A/1B light chain 3, and MLP3A.

References

1. Shpilka, T., Weidberg, H., Pietrokovski, S., & Elazar, Z. (2011). Atg8: an autophagy-related ubiquitin-like protein family. Genome biology. https://doi.org/10.1186/gb-2011-12-7-226

2. Koukourakis, M. I., Kalamida, D., Giatromanolaki, A., Zois, C. E., Sivridis, E., Pouliliou, S., Mitrakas, A., Gatter, K. C., & Harris, A. L. (2015). Autophagosome Proteins LC3A, LC3B and LC3C Have Distinct Subcellular Distribution Kinetics and Expression in Cancer Cell Lines. PloS one. https://doi.org/10.1371/journal.pone.0137675

3. Weidberg, H., Shvets, E., & Elazar, Z. (2011). Biogenesis and cargo selectivity of autophagosomes. Annual review of biochemistry. https://doi.org/10.1146/annurev-biochem-052709-094552

4. Tanida, I., Ueno, T., & Kominami, E. (2004). LC3 conjugation system in mammalian autophagy. The international journal of biochemistry & cell biology. https://doi.org/10.1016/j.biocel.2004.05.009

5. Schaaf, M. B., Keulers, T. G., Vooijs, M. A., & Rouschop, K. M. (2016). LC3/GABARAP family proteins: autophagy-(un)related functions. FASEB journal : official publication of the Federation of American Societies for Experimental Biology. https://doi.org/10.1096/fj.201600698R

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00008878-M01
Species: Bv, Ha, Hu, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NB500-249
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, Simple Western, WB
H00002965-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, KD, S-ELISA, WB
NBP1-31381
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-37399
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-02627
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-20254
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB600-607
Species: Hu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NB110-53818
Species: Al, Bv, Dr, Fi, Gp, Hu, Mu, Po, Pm, Rt, Xp, Ze
Applications: EM, ELISA, Flow, IB, ICC/IF, IHC,  IHC-P, IP, KD, KO, PLA, RIA, Simple Western, WB
NBP2-82090
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-55202
Species: Hu
Applications: IHC,  IHC-P, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
MAB6608
Species: Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
NB100-56098
Species: Ca, Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NB120-19294
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB

Publications for LC3A Antibody (NB100-2331)(309)

We have publications tested in 10 confirmed species: Human, Mouse, Rat, Amphibian, Bovine, Canine, Fish, Plant, SARS-CoV, Zebrafish.

We have publications tested in 11 applications: Chemotaxis, ELISA, FLOW, IB, ICC/IF, IF/IHC, IHC-Fr, IHC-P, IHC-WhMt, IP, WB.


Filter By Application
Chemotaxis
(1)
ELISA
(2)
FLOW
(2)
IB
(1)
ICC/IF
(40)
IF/IHC
(10)
IHC-Fr
(6)
IHC-P
(5)
IHC-WhMt
(1)
IP
(4)
WB
(177)
All Applications
Filter By Species
Human
(98)
Mouse
(78)
Rat
(14)
Amphibian
(1)
Bovine
(1)
Canine
(2)
Fish
(2)
Plant
(1)
SARS-CoV
(1)
Zebrafish
(9)
All Species
Showing Publications 1 - 10 of 309. Show All 309 Publications.
Publications using NB100-2331 Applications Species
Yamashita A, Ignatenko O, Nguyen M et al. Depletion of LONP2 unmasks differential requirements for peroxisomal function between cell types and in cholesterol metabolism bioRxiv 2023-03-19 (WB) WB
Karanasios E, Ktistakis NT. Studying Autophagy: List of Useful Antibodies Produced via a Community Effort. Autophagy at the Cell, Tissue and Organismal Level. 2016-04-24
Johansson L, Sandberg A, Nyström S, Hammarström P et Al. Amyloid beta 1-40 and 1-42 fibril ratios and maturation level cause conformational differences with minimal impact on autophagy and cytotoxicity J Neurochem 2024-08-12 [PMID: 39133499]
Yongrong Liao, Leonid Andronov, Xiaotian Liu, Junyan Lin, Lucile Guerber, Linjie Lu, Arantxa Agote-Arán, Evanthia Pangou, Li Ran, Charlotte Kleiss, Mengdi Qu, Stephane Schmucker, Luca Cirillo, Zhirong Zhang, Daniel Riveline, Monica Gotta, Bruno P. Klaholz, Izabela Sumara UBAP2L ensures homeostasis of nuclear pore complexes at the intact nuclear envelope The Journal of Cell Biology 2024-07-01 [PMID: 38652117]
Mayer J, Boeck D, Werner M et Al. Inhibition of Autophagy Alters Intracellular Transport of APP Resulting in Increased APP Processing Traffic 2024-04-15 [PMID: 38613404]
Katariina Nurmi, Kristiina Silventoinen, Salla Keskitalo, Kristiina Rajamäki, Vesa-Petteri Kouri, Matias Kinnunen, Sami Jalil, Rocio Maldonado, Kirmo Wartiovaara, Elma Inés Nievas, Silvina Paola Denita-Juárez, Christopher J.A. Duncan, Outi Kuismin, Janna Saarela, Inka Romo, Timi Martelius, Jukka Parantainen, Arzu Beklen, Marcelina Bilicka, Sampsa Matikainen, Dan C. Nordström, Meri Kaustio, Ulla Wartiovaara-Kautto, Outi Kilpivaara, Christoph Klein, Fabian Hauck, Tiina Jahkola, Timo Hautala, Markku Varjosalo, Goncalo Barreto, Mikko R.J. Seppänen, Kari K. Eklund Truncating NFKB1 variants cause combined NLRP3 inflammasome activation and type I interferon signaling and predispose to necrotizing fasciitis Cell Reports Medicine 2024-04-08 [PMID: 38593810]
Melania Scarcella, Gianluca Scerra, Mariangela Ciampa, Marianna Caterino, Michele Costanzo, Laura Rinaldi, Antonio Feliciello, Serenella Anzilotti, Chiara Fiorentino, Maurizio Renna, Margherita Ruoppolo, Luigi Michele Pavone, Massimo D’Agostino, Valeria De Pasquale Metabolic rewiring and autophagy inhibition correct lysosomal storage disease in mucopolysaccharidosis IIIB iScience 2024-01-29 [PMID: 38361619]
Clara Bayona, Lía Alza, Teodora Ranđelović, Marta C. Sallán, Anna Visa, Carles Cantí, Ignacio Ochoa, Sara Oliván, Judit Herreros Tetralol derivative NNC-55-0396 targets hypoxic cells in the glioblastoma microenvironment: an organ-on-chip approach Cell Death & Disease 2024-02-10 [PMID: 38341408]
Show All 309 Publications.

Reviews for LC3A Antibody (NB100-2331) (22) 4.322

Average Rating: 4.3
(Based on 22 reviews)
We have 22 reviews tested in 5 species: Human, Mouse, Rat, Human and Mouse, Other.

Reviews using NB100-2331:
Filter by Applications
ICC
(1)
WB
(18)
IF
(1)
 IHC-P
(1)
IHC
(1)
All Applications
Filter by Species
Human
(10)
Mouse
(8)
Rat
(1)
Human and Mouse
(1)
Other
(1)
All Species
Images Ratings Applications Species Date Details
Immunocytochemistry LC3A NB100-2331
Enlarge
4
reviewed by:
Verified Customer
ICC Human 05/21/2021
View

Summary

ApplicationImmunocytochemistry
Sample TestedHuman microglia cell lysate,Human microglia
SpeciesHuman
LotAK
Western Blot LC3A NB100-2331
Enlarge
4
reviewed by:
Verified Customer
WB Rat 05/21/2021
View

Summary

ApplicationWestern Blot
Sample TestedMICROGLIA
SpeciesRat
LotAK
Western Blot LC3A NB100-2331
Enlarge
5
reviewed by:
Verified Customer
WB Human 06/09/2020
View

Summary

ApplicationWestern Blot
Sample TestedTHP-1 cell lysate
SpeciesHuman
LotAB-3

Comments

CommentsThe antibody works great to detect the LC3 from THP-1 cell lysates
Western Blot LC3A NB100-2331
Enlarge
4
reviewed by:
Verified Customer
WB Mouse 01/29/2019
View

Summary

ApplicationWestern Blot
Sample Testedlysed cell lines, Sample Amount: 20 ug
SpeciesMouse
LotA6-NB100-2331
Western Blot LC3A NB100-2331
Enlarge
4
reviewed by:
Verified Customer
WB Human and Mouse 11/25/2017
View

Summary

ApplicationWestern Blot
Sample Testedmouse hepatocytes and HepG2 cells
SpeciesHuman and Mouse
LotAC-1
Western Blot LC3A NB100-2331
Enlarge
5
reviewed by:
Verified Customer
WB Mouse 08/07/2017
View

Summary

ApplicationWestern Blot
Sample TestedMouse macrophage cell line RAW 264.7
SpeciesMouse
LotH6-NB100-2331
  5
reviewed by:
jennifer guadagno
WB Mouse 10/06/2015
View

Summary

ApplicationWestern Blot
Sample TestedMouse Neuro2A, Mouse Cortical Neurons whole cell lysate
SpeciesMouse
LotR-4
Western Blot LC3A NB100-2331
Enlarge
5
reviewed by:
Verified Customer
WB Human 01/12/2015
View

Summary

ApplicationWestern Blot
Sample Testedhuman glioblastoma
SpeciesHuman
  4
reviewed by:
Verified Customer
WB Mouse 12/12/2014
View

Summary

ApplicationWestern Blot
Sample TestedSee PMID 22892563
SpeciesMouse
Immunofluorescence LC3A NB100-2331
Enlarge
5
reviewed by:
Verified Customer
IF Mouse 11/25/2014
View

Summary

ApplicationImmunofluorescence
Sample TestedNIH3T3, HeLa, HEK293T, N2a neuroblastoma, Q7 striatal, Sy5Y neuroblastoma
SpeciesMouse
Immunohistochemistry-Paraffin LC3A NB100-2331
Enlarge
4
reviewed by:
Merissa Olmer
 IHC-P 10/04/2014
View

Summary

ApplicationImmunohistochemistry-Paraffin
LotS-1
Western Blot LC3A NB100-2331
Enlarge
4
reviewed by:
Ilya Ulasov
WB Human 06/30/2014
View

Summary

ApplicationWestern Blot
Sample Testedhuman tumor cells
SpeciesHuman
Lotq-1
  4
reviewed by:
Verified Customer
WB Human 06/20/2014
View

Summary

ApplicationWestern Blot
SpeciesHuman
Western Blot LC3A NB100-2331
Enlarge
3
reviewed by:
Kumsal Tekirdag
WB Human 04/02/2014
View

Summary

ApplicationWestern Blot
SpeciesHuman
LotS-2
Immunohistochemistry LC3A NB100-2331
Enlarge
4
reviewed by:
Nirmala Parajuli
IHC Mouse 08/13/2012
View

Summary

ApplicationImmunohistochemistry
Sample TestedRenal tissue (paraffin block)
SpeciesMouse
LotN
Western Blot LC3A NB100-2331
Enlarge
4
reviewed by:
Verified Customer
WB Human 12/28/2011
View

Summary

ApplicationWestern Blot
Sample TestedHuman
SpeciesHuman
  5
reviewed by:
Verified Customer
WB Human 11/21/2011
View

Summary

ApplicationWestern Blot
Sample TestedHuman
SpeciesHuman
  5
reviewed by:
Verified Customer
WB Human 11/21/2011
View

Summary

ApplicationWestern Blot
Sample TestedHuman
SpeciesHuman
  5
reviewed by:
Verified Customer
WB Mouse 10/24/2011
View

Summary

ApplicationWestern Blot
Sample TestedMouse
SpeciesMouse
  5
reviewed by:
Seung-Hyun Ro
WB Mouse 07/08/2010
View

Summary

ApplicationWestern Blot
Sample Tested3T3-L1 adipocyte, Sample Amount: 30ug
SpeciesMouse
LotH2
  3
reviewed by:
Verified Customer
WB Other 11/05/2009
View

Summary

ApplicationWestern Blot
Sample Testedlysed cell lines, Sample Amount: 20 ug
SpeciesOther
LotJ
  4
reviewed by:
Verified Customer
WB Human 02/18/2009
View

Summary

ApplicationWestern Blot
Sample TestedHuman cancer cells, Sample Amount: 80ug
SpeciesHuman
LotSS

Product General Protocols

Video Protocols

WB Video Protocol
ChIP Webinar
ChIP Video Protocol
ICC/IF Video Protocol

FAQs for LC3A Antibody (NB100-2331). (Showing 1 - 2 of 2 FAQs).

  1. I am interested in detecting the LC3 protein in the sea anemone Aiptasia. I have used your LC3 antibody (NB100-2331) and got a band in my Western blot at around 15 kD, which seems reasonable. However I would like to know how likely it is that your antibody binds to the LC3 protein of Aiptasia? Unfortunately I could not find the protein sequence against which the LC3 antibody was raised to and am hoping you could help me. The protein sequence for the Aiptasia LC3 is: MGDNNVLSYKPFKQRKSFVSRRDEVAGIRAKFPSKVPVIVERYHKERDLPLLDKTKFLVPQELTMSQFVTIIRNRMSLSS TQAFYLIVNNKSLASMSMTMAELYREEKDEDGFLYMVYASQEMFGCNS
    • In comparing the sequences of the human LC3 and Aiptasia proteins, and it seems as though there is very low homology. There is only 62% sequence similarity, and we generally don't recommend antibodies for novel species unless they have at least 85%. There is a chance that it will work, but we cannot guarantee it.
  2. Do you have any data or reason to believe the your LC3 antibody (NB100-2331) has a higher affinity to LC3-II than to LC3-I?
    • No, we do not have any data or reason to believe that NB100-2331 has a higher affinity to LC3-II than to LC3-I. This antibody was raised using a synthetic peptide made to an internal portion of the human LC3 protein sequence (between residues 25-121) as an immunogen and is expected to detect both LC3-I as well as LC3-II, and their signal will depend upon their respective amounts being present in your samples at the time of detection.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional LC3A Products

Research Areas for LC3A Antibody (NB100-2331)

Find related products by research area.

Blogs on LC3A.


  Read full blog post.

Losing memory: Toxicity from mutant APP and amyloid beta explain the hippocampal neuronal damage in Alzheimer's disease
 By Jamshed Arslan Pharm.D.  Alzheimer's disease (AD) is an irreversible brain disorder that destroys memory and thinking skills. The telltale signs of AD brains are extracellular deposits of amy...  Read full blog post.

Nuclear LC3: Why is it there and what is it doing?
By Christina Towers, PhD. Cells use the complex process of autophagy to degrade and recycle cytoplasmic material.  There are over 20 proteins that have been implicated in this process and appropriately named core ...  Read full blog post.

Why LC3B Antibodies Make Ideal Autophagosomes Membrane Markers
The human form of microtubule-associated protein light chain 3 (LC3) is expressed as 3 splice variants LC3A, LC3B, and LC3C.1 LC3B is a subunit of the MAP1A and MAP1B microtubule-binding proteins and plays a central role in autophagosome membrane stru...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4.3
5
9
4
11
3
2
2
0
1
0

Verified Customer
05/21/2021
Application: ICC
Species: Human

Verified Customer
05/21/2021
Application: WB
Species: Rat

Verified Customer
06/09/2020
Application: WB
Species: Human

Bioinformatics

Gene Symbol MAP1LC3A