Lactate Dehydrogenase B Antibody

Images

 
Western Blot: Lactate Dehydrogenase B Antibody [NBP1-55415] - Sample Tissue: Human Fetal Lung, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1ug/ml, Peptide ...read more
Immunocytochemistry/ Immunofluorescence: Lactate Dehydrogenase B Antibody [NBP1-55415] - Human lung adenocarcinoma cell line A549, 2.5.
Immunohistochemistry: Lactate Dehydrogenase B Antibody [NBP1-55415] - Human Placenta Antibody Concentration: 5 ug/ml.
Western Blot: Lactate Dehydrogenase B Antibody [NBP1-55415] - Human pancreatic cancer cell line MiaPaca-2 and Panc-1, concentration 1 ug/ml.
Western Blot: Lactate Dehydrogenase B Antibody [NBP1-55415] - 721_B Whole Cell, concentration 1 ug/ml.
Western Blot: Lactate Dehydrogenase B Antibody [NBP1-55415] - Antibody Titration: 1 ug/ml Human 721_B.
Western Blot: Lactate Dehydrogenase B Antibody [NBP1-55415] - Antibody Titration: 1 ug/ml Human Raji.
Western Blot: Lactate Dehydrogenase B Antibody [NBP1-55415] - Lanes: 1. 30 ug MiaPaca-2 cell lysate 2. 30 ug Panc-1 cell lysate Primary, Antibody Dilution: 1 : 1000 Secondary Antibody: Goat anti-Rabbit HRP Secondary, ...read more
Western Blot: Lactate Dehydrogenase B Antibody [NBP1-55415] - Lane A: Human Fetal Lung Lane B: Human HCT116 Lane C: Human 293T, Antibody Dilution: 0.2 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Lactate Dehydrogenase B Antibody Summary

Background
Sample Tissue: Human Fetal Lung, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1ug/ml, Peptide Concentration: 5ug/ml, Lysate Quantity: 25ug/lane/lane, Gel Concentration: 0.12
Immunogen
Synthetic peptides corresponding to LDHB(lactate dehydrogenase B) The peptide sequence was selected from the C terminal of LDHB. Peptide sequence MYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKD.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LDHB
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunocytochemistry/Immunofluorescence 1:10-1:2000
  • Immunohistochemistry
Application Notes
This is a rabbit polyclonal antibody against LDHB and was validated on Western blot.
Theoretical MW
37 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using
NBP1-55415 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Lactate Dehydrogenase B Antibody

  • EC 1.1.1
  • EC 1.1.1.27
  • Epididymis Secretory Protein Li 281
  • HEL-S-281
  • Lactate Dehydrogenase B
  • LDH heart subunit
  • LDHB
  • LDH-B
  • LDHBD
  • LDH-H
  • L-lactate dehydrogenase B chain
  • Renal Carcinoma Antigen NY-REN-46
  • TRG-5

Background

LDHB belongs to the LDH/MDH superfamily, LDH family. Defects in LDHB are a cause of hereditary LDHB deficiency. LDHB may also have roles in progression of medulloblastoma.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-48336
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-92065
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31470
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-236
Species: Hu, Mu
Applications: WB, IB, IHC, IHC-Fr, IHC-P, IP
NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31589
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-25147
Species: Hu, Mu, Rt, Bv, Xp
Applications: WB, Simple Western, ICC/IF
NBP1-87404
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-32398
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
NBP1-32259
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-02043
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-54755
Species: Hu
Applications: WB
NBP1-87311
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-34980
Species: Hu
NBP1-84956
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00005236-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP, RNAi
NBP1-55415
Species: Hu
Applications: WB, ICC/IF, IHC

Publications for Lactate Dehydrogenase B Antibody (NBP1-55415)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for Lactate Dehydrogenase B Antibody (NBP1-55415) (0)

There are no reviews for Lactate Dehydrogenase B Antibody (NBP1-55415). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Lactate Dehydrogenase B Antibody (NBP1-55415) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Lactate Dehydrogenase B Products

Bioinformatics Tool for Lactate Dehydrogenase B Antibody (NBP1-55415)

Discover related pathways, diseases and genes to Lactate Dehydrogenase B Antibody (NBP1-55415). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Lactate Dehydrogenase B Antibody (NBP1-55415)

Discover more about diseases related to Lactate Dehydrogenase B Antibody (NBP1-55415).
 

Pathways for Lactate Dehydrogenase B Antibody (NBP1-55415)

View related products by pathway.

PTMs for Lactate Dehydrogenase B Antibody (NBP1-55415)

Learn more about PTMs related to Lactate Dehydrogenase B Antibody (NBP1-55415).
 

Research Areas for Lactate Dehydrogenase B Antibody (NBP1-55415)

Find related products by research area.

Blogs on Lactate Dehydrogenase B

There are no specific blogs for Lactate Dehydrogenase B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Lactate Dehydrogenase B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LDHB
Entrez
Uniprot