Lactate Dehydrogenase B Antibody


Western Blot: Lactate Dehydrogenase B Antibody [NBP1-55415] - Sample Tissue: Human Fetal Lung, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1ug/ml, Peptide more
Immunocytochemistry/ Immunofluorescence: Lactate Dehydrogenase B Antibody [NBP1-55415] - Human lung adenocarcinoma cell line A549, 2.5.
Immunohistochemistry: Lactate Dehydrogenase B Antibody [NBP1-55415] - Human Placenta Antibody Concentration: 5 ug/ml.
Western Blot: Lactate Dehydrogenase B Antibody [NBP1-55415] - Human pancreatic cancer cell line MiaPaca-2 and Panc-1, concentration 1 ug/ml.
Western Blot: Lactate Dehydrogenase B Antibody [NBP1-55415] - 721_B Whole Cell, concentration 1 ug/ml.
Western Blot: Lactate Dehydrogenase B Antibody [NBP1-55415] - Antibody Titration: 1 ug/ml Human 721_B.
Western Blot: Lactate Dehydrogenase B Antibody [NBP1-55415] - Antibody Titration: 1 ug/ml Human Raji.
Western Blot: Lactate Dehydrogenase B Antibody [NBP1-55415] - Lanes: 1. 30 ug MiaPaca-2 cell lysate 2. 30 ug Panc-1 cell lysate Primary, Antibody Dilution: 1 : 1000 Secondary Antibody: Goat anti-Rabbit HRP Secondary, more
Western Blot: Lactate Dehydrogenase B Antibody [NBP1-55415] - Lane A: Human Fetal Lung Lane B: Human HCT116 Lane C: Human 293T, Antibody Dilution: 0.2 ug/ml.

Product Details

Reactivity Hu, Mu, Rt, Bv, Ca, Eq, Gp, Rb, ZeSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

Lactate Dehydrogenase B Antibody Summary

Sample Tissue: Human Fetal Lung, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1ug/ml, Peptide Concentration: 5ug/ml, Lysate Quantity: 25ug/lane/lane, Gel Concentration: 0.12
Synthetic peptides corresponding to LDHB(lactate dehydrogenase B) The peptide sequence was selected from the C terminal of LDHB. Peptide sequence MYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKD. The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (100%), Rat (93%), Canine (100%), Equine (93%), Zebrafish (91%), Bovine (93%), Guinea Pig (93%), Rabbit (100%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
  • Immunocytochemistry/Immunofluorescence 1:10-1:2000
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
Application Notes
This is a rabbit polyclonal antibody against LDHB and was validated on Western blot.
Theoretical MW
37 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Lactate Dehydrogenase B Knockout 293T Cell Lysate
Read Publication using
NBP1-55415 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Lactate Dehydrogenase B Antibody

  • EC 1.1.1
  • EC
  • Epididymis Secretory Protein Li 281
  • HEL-S-281
  • Lactate Dehydrogenase B
  • LDH heart subunit
  • LDHB
  • LDH-B
  • LDH-H
  • L-lactate dehydrogenase B chain
  • Renal Carcinoma Antigen NY-REN-46
  • TRG-5


LDHB belongs to the LDH/MDH superfamily, LDH family. Defects in LDHB are a cause of hereditary LDHB deficiency. LDHB may also have roles in progression of medulloblastoma.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Po, Bv
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt, Bv, V-Vi
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IB, IHC, IHC-Fr, IP
Species: Hu, Mu, Rt, Po, Av, Bv, Ca, Ch, ChHa, Eq, Fe, Ha, Ma-Op, Pm, Rb, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Single-Cell Western
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, IF
Species: Hu, Fe
Applications: WB, ELISA, Flow, Func, ICC/IF, IHC, IHC-P, IP, S-ELISA
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, KD
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Bv
Applications: WB, ELISA, ICC/IF, IP, RNAi, S-ELISA
Species: Hu, Mu, Rt, Bv, Ca, Eq, Gp, Rb, Ze
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Lactate Dehydrogenase B Antibody (NBP1-55415)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for Lactate Dehydrogenase B Antibody (NBP1-55415) (0)

There are no reviews for Lactate Dehydrogenase B Antibody (NBP1-55415). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Lactate Dehydrogenase B Antibody (NBP1-55415) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional Lactate Dehydrogenase B Products

Bioinformatics Tool for Lactate Dehydrogenase B Antibody (NBP1-55415)

Discover related pathways, diseases and genes to Lactate Dehydrogenase B Antibody (NBP1-55415). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Lactate Dehydrogenase B Antibody (NBP1-55415)

Discover more about diseases related to Lactate Dehydrogenase B Antibody (NBP1-55415).

Pathways for Lactate Dehydrogenase B Antibody (NBP1-55415)

View related products by pathway.

PTMs for Lactate Dehydrogenase B Antibody (NBP1-55415)

Learn more about PTMs related to Lactate Dehydrogenase B Antibody (NBP1-55415).

Research Areas for Lactate Dehydrogenase B Antibody (NBP1-55415)

Find related products by research area.

Blogs on Lactate Dehydrogenase B

There are no specific blogs for Lactate Dehydrogenase B, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Lactate Dehydrogenase B Antibody and receive a gift card or discount.


Gene Symbol LDHB