ME2 Antibody

Immunohistochemistry-Paraffin: ME2 Antibody [NBP1-89559] - Staining in human duodenum and liver tissues using anti-ME2 antibody. Corresponding ME2 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: ME2 Antibody [NBP1-89559] - Staining of human cerebral cortex, colon, lymph node and testis using Anti-ME2 antibody NBP1-89559 (A) shows similar protein distribution across tissues to independent antibody NBP1-82434 (B).

Western Blot: ME2 Antibody [NBP1-89559] - Analysis using Anti-ME2 antibody NBP1-89559 (A) shows similar pattern to independent antibody NBP1-82434 (B).

Immunohistochemistry-Paraffin: ME2 Antibody [NBP1-89559] - Staining of human colon.

Western Blot: ME2 Antibody [NBP1-89559] - Analysis in human cell line Daudi.

Immunohistochemistry-Paraffin: ME2 Antibody [NBP1-89559] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: ME2 Antibody [NBP1-89559] - Staining of human duodenum shows high expression.

Immunohistochemistry-Paraffin: ME2 Antibody [NBP1-89559] - Staining of human liver shows low expression as expected.

Immunohistochemistry-Paraffin: ME2 Antibody [NBP1-89559] - Staining of human lymph node.

Immunohistochemistry-Paraffin: ME2 Antibody [NBP1-89559] - Staining of human cerebral cortex.

• Reactivity: Hu
• Applications: WB, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

ME2 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KVISKPISEHKILFLGAGEAALGIANLIVMSMVENGLSEQEAQKKIWMFDKYGLLVKGRKAKIDSYQEPFTHSAPESIPDTFEDAVNILKPSTIIGVAGAGRLFTPDVIRAMASINERPVIFALSNPTA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ME2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Theoretical MW: 65 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  ME2 Protein (NBP1-89559PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%), Rat (80%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ME2 Antibody

• EC 1.1.1
• EC 1.1.1.38
• malate dehydrogenase
• Malic enzyme 2
• malic enzyme 2, NAD(+)-dependent, mitochondrial
• NAD-dependent malic enzyme, mitochondrial
• NAD-ME
• ODS1
• pyruvic-malic carboxylase

Background

The ME2 gene encodes a mitochondrial NAD-dependent malic enzyme, a homotetrameric protein, that catalyzes the oxidative decarboxylation of malate to pyruvate. It had previously been weakly linked to a syndrome known as Friedreich ataxia that has since been s

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ME2 Antibody (NBP1-89559)(4)

Publications using NBP1-89559

• Brown LJ, Longacre MJ, Hasan NM et al. Chronic reduction of the cytosolic or mitochondrial NAD(P)-malic enzyme does not affect insulin secretion in a rat insulinoma cell line. J Biol Chem. 2009-12-01 [PMID: 19858194]
• Zoccarato F, Cavallini L, Alexandre A et al. Succinate is the controller of O2-/H2O2 release at mitochondrial complex I : negative modulation by malate, positive by cyanide. J Bioenerg Biomembr. 2009-08-01 [PMID: 19821037]
• MacDonald MJ, Longacre MJ, Kendrick MA et al. Mitochondrial malic enzyme (ME2) in pancreatic islets of the human, rat and mouse and clonal insulinoma cells. Arch Biochem Biophys. 2009-08-01 [PMID: 19691144]
• Tsuyuguchi I, Kawasumi H, Takashima T et al. Mycobacterium avium-Mycobacterium intracellular complex-induced suppression of T-cell proliferation in vitro by regulation of monocyte accessory cell activity. Infect Immun. 1990-05-01 [PMID: 1691144]

Bioinformatics

• Gene Symbol: ME2
• Entrez:
  • 4200(Human)
• Uniprot:
  • P23368(Human)