Adenosine Deaminase/ADA Antibody

Images

 
Western Blot: Adenosine Deaminase/ADA Antibody [NBP1-87404] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: Adenosine Deaminase/ADA Antibody [NBP1-87404] - Staining of human duodenum shows strong positivity in glandular cells.
Western Blot: Adenosine Deaminase/ADA Antibody [NBP1-87404] - Analysis in human cell line MOLT-4.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Adenosine Deaminase/ADA Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GDETIPGSSLLPGHVQAYQEAVKSGIHRTVHAGEVGSAEVVKEAVDILKTERLGHGYHTLEDQALYNRLRQENMHFEICPWSSYLTGAWKPDTEHAVIRLKNDQANYSLNTDDPLIFKSTLDTDYQMTKRDMGFTEEE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ADA
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Theoretical MW
41 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
Adenosine Deaminase/ADA Protein (NBP1-87404PEP)
Publications
Read Publications using
NBP1-87404 in the following applications:

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24743550)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Adenosine Deaminase/ADA Antibody

  • ADA
  • ADA1
  • adenine deaminase
  • Adenosine aminohydrolase
  • Adenosine Deaminase
  • EC 3.5.4.4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00000103-Q01
Species: Hu
AF6486
Species: Hu
Applications: WB, Simple Western
NBP1-85740
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
AF1180
Species: Hu
Applications: WB, Simple Western, IHC, ICC
MAB6240
Species: Hu
Applications: WB, IHC
NBP2-15291
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB600-935
Species: Bv
Applications: WB, ELISA, IP
NBP1-89238
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NB100-1793
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP2-57507
Species: Hu
Applications: ICC/IF
AF6466
Species: Hu
Applications: WB
NB100-230
Species: Hu
Applications: WB, IP, PLA
NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NB100-233
Species: Hu
Applications: WB, PLA

Publications for Adenosine Deaminase/ADA Antibody (NBP1-87404)(3)

Reviews for Adenosine Deaminase/ADA Antibody (NBP1-87404) (0)

There are no reviews for Adenosine Deaminase/ADA Antibody (NBP1-87404). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Adenosine Deaminase/ADA Antibody (NBP1-87404) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Adenosine Deaminase/ADA Products

Bioinformatics Tool for Adenosine Deaminase/ADA Antibody (NBP1-87404)

Discover related pathways, diseases and genes to Adenosine Deaminase/ADA Antibody (NBP1-87404). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Adenosine Deaminase/ADA Antibody (NBP1-87404)

Discover more about diseases related to Adenosine Deaminase/ADA Antibody (NBP1-87404).
 

Pathways for Adenosine Deaminase/ADA Antibody (NBP1-87404)

View related products by pathway.

PTMs for Adenosine Deaminase/ADA Antibody (NBP1-87404)

Learn more about PTMs related to Adenosine Deaminase/ADA Antibody (NBP1-87404).

Blogs on Adenosine Deaminase/ADA

There are no specific blogs for Adenosine Deaminase/ADA, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Adenosine Deaminase/ADA Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ADA
Entrez
Uniprot