ME3 Antibody - Azide and BSA Free

Western Blot: ME3 Antibody [NBP3-05078] - Analysis of extracts of various cell lines, using ME3 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit

Immunocytochemistry/Immunofluorescence: ME3 Antibody [NBP3-05078] - Analysis of L929 cells using ME3 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunohistochemistry-Paraffin: ME3 Antibody [NBP3-05078] - Immunohistochemistry of paraffin-embedded Human colon carcinoma using ME3 Rabbit pAb (NBP3-05078) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry-Paraffin: ME3 Antibody [NBP3-05078] - Immunohistochemistry of paraffin-embedded Mouse heart using ME3 Rabbit pAb (NBP3-05078) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry-Paraffin: ME3 Antibody [NBP3-05078] - Immunohistochemistry of paraffin-embedded Rat ovary using ME3 Rabbit pAb (NBP3-05078) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

ME3 Antibody - Azide and BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 505-604 of human ME3 (NP_001014811.1). IRHIPDEIFLLTAEQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIAIKVLDYAYKHNLASYYPEPKDKEAFVRSLVYTPDYDSFTLDSYTWPKEAMNVQTV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ME3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 1:50-1:200
  • Immunohistochemistry 1:50-1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500-1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS with 50% glycerol, pH7.3.
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for ME3 Antibody - Azide and BSA Free

• EC 1.1.1
• EC 1.1.1.40
• FLJ34862
• malate dehydrogenase
• Malic enzyme 3
• malic enzyme 3, NADP(+)-dependent, mitochondrial
• malic enzyme, NADP+-dependent, mitochondrial
• mitochondrial NADP(+)-dependent malic enzyme 3
• NADP-dependent malic enzyme, mitochondrial
• NADP-ME
• pyruvic-malic carboxylase

Background

Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis, metastasis, and atherosclerosis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ME3