PHGDH Antibody

Images

 
Western Blot: PHGDH Antibody [NBP1-87311] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: PHGDH Antibody [NBP1-87311] - Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & cytosol.
Immunohistochemistry-Paraffin: PHGDH Antibody [NBP1-87311] - Immunohistochemical staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neuronal and glial cells.
Western Blot: PHGDH Antibody [NBP1-87311] - Analysis in human cell line U-87 MG.
Immunohistochemistry-Paraffin: PHGDH Antibody [NBP1-87311] - Immunohistochemical staining of human skeletal muscle shows no positivity as expected.
Immunohistochemistry-Paraffin: PHGDH Antibody [NBP1-87311] - Immunohistochemical staining of human breast cancer shows moderate to strong cytoplasmic positivity in tumor cells.
Immunohistochemistry-Paraffin: PHGDH Antibody [NBP1-87311] - Immunohistochemical staining of human skin shows moderate cytoplasmic positivity in epidermal cells.
Simple Western: PHGDH Antibody [NBP1-87311] - Simple Western lane view shows a specific band for PHGDH in 0.2 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. This experiment was performed under reducing conditions ...read more
Simple Western: PHGDH Antibody [NBP1-87311] - Electropherogram image(s) of corresponding Simple Western lane view. PHGDH antibody was used at 1:20 dilution on RT-4 and U-251MG lysate(s).

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, Simple Western, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PHGDH Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LEEIWPLCDFITVHTPLLPSTTGLLNDNTFAQCKKGVRVVNCARGGIVDEGALLRALQSGQCAGAALDVFTEEPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIAVQFVDM
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PHGDH
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Simple Western 1:20
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:500-1:1000
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.
Control Peptide
PHGDH Protein (NBP1-87311PEP)
Publications
Read Publications using
NBP1-87311 in the following applications:

Reactivity Notes

Reactivity reported in scientific literature (PMID: 22438825)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PHGDH Antibody

  • 3,3-phosphoglycerate dehydrogenase
  • 3PGDH
  • 3-PGDH
  • D-3-phosphoglycerate dehydrogenase
  • EC 1.1.1
  • EC 1.1.1.95
  • MGC3017
  • PDG
  • PGAD
  • PGD
  • PGDH
  • phosphoglycerate dehydrogenase
  • SERA

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-79280
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
MAB6487
Species: Hu
Applications: WB, ICC
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-19014
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-00178
Species: Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP1-49879
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-32421
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00005236-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP, RNAi
NBP1-32550
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-59438
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP2-30764
Species: Hu
Applications: IHC, IHC-P
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF2667
Species: Hu
Applications: WB, IHC
NBP1-87311
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P

Publications for PHGDH Antibody (NBP1-87311)(6)

Reviews for PHGDH Antibody (NBP1-87311) (0)

There are no reviews for PHGDH Antibody (NBP1-87311). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PHGDH Antibody (NBP1-87311). (Showing 1 - 1 of 1 FAQs).

  1. We would like to know the concentration of this antibody for IHC.
    • The concentration of our latest lot of NBP1-87311 is 0.2 mg/mL. We recommend using it at a dilution of 1:500-1:1000 for IHC.

Secondary Antibodies

 

Isotype Controls

Additional PHGDH Products

Bioinformatics Tool for PHGDH Antibody (NBP1-87311)

Discover related pathways, diseases and genes to PHGDH Antibody (NBP1-87311). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PHGDH Antibody (NBP1-87311)

Discover more about diseases related to PHGDH Antibody (NBP1-87311).
 

Pathways for PHGDH Antibody (NBP1-87311)

View related products by pathway.

PTMs for PHGDH Antibody (NBP1-87311)

Learn more about PTMs related to PHGDH Antibody (NBP1-87311).
 

Research Areas for PHGDH Antibody (NBP1-87311)

Find related products by research area.

Blogs on PHGDH

There are no specific blogs for PHGDH, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PHGDH Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PHGDH