Integrin alpha 8 Antibody - BSA Free

Immunohistochemistry-Paraffin: Integrin alpha 8 Antibody [NBP1-86519] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Immunohistochemistry-Paraffin: Integrin alpha 8 Antibody [NBP1-86519] - Staining of human kidney shows strong membranous positivity in cells in glomeruli, while cells in tubules are negative.

Immunohistochemistry-Paraffin: Integrin alpha 8 Antibody [NBP1-86519] - Staining of human lung shows weak to moderate membranous positivity in pneumocytes.

Immunohistochemistry-Paraffin: Integrin alpha 8 Antibody [NBP1-86519] - Staining of human small intestine shows weak to moderate membranous positivity in smooth muscle cells.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Integrin alpha 8 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: HKEEEVGPLVEHIYELHNIGPSTISDTILEVGWPFSARDEFLLYIFHIQTLGPLQCQPNPNINPQDIKPAASPEDTPELSAFLRNSTIPHLVRKRDVHVVEFHRQSPAKILNCTNIECLQISCA
• Localization: Membrane; Single-pass type I membrane protein.
• Predicted Species: Mouse (91%), Rat (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ITGA8
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Integrin alpha 8 Protein (NBP1-86519PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Integrin alpha 8 Antibody - BSA Free

• Integrin alpha 8
• integrin alpha-8
• integrin, alpha 8
• ITGA8

Background

ITGA8 is a gene that codes for a protein that functions in the genesis of kidneys and other organs by facilitating the recruitment of mesenchymal cells into epithelial structures as well as working as a neuronal receptor for TNC to regulate neurite outgrowth, and is made up of 1063 amino acids, weighs approximately 117 kDa. Studies are being conducted on several diseases and disorders including keratopathy, carcinoma, kidney disease, laryngitis, Parkinson's disease, glomerulonephritis, Alzheimer's disease, melanoma, hepatitis, and neuronitis. ITGA8 has also been shown to have interactions with FN1, ITGB1, ITGA3, NPNT, and VNT in pathways such as the CDK5, Tec kinases signaling, integrin-mediated cell adhesion, signal transduction, and hypertrophic cardiomyopathy pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Integrin alpha 8 Antibody (NBP1-86519)(3)

Publications using NBP1-86519

• Shintaro Komatsu, Noritoshi Kato, Hiroki Kitai, Yoshio Funahashi, Yuhei Noda, Shoma Tsubota, Akihito Tanaka, Yuka Sato, Kayaho Maeda, Shoji Saito, Kazuhiro Furuhashi, Takuji Ishimoto, Tomoki Kosugi, Shoichi Maruyama, Kenji Kadomatsu Detecting and exploring kidney-derived extracellular vesicles in plasma Clinical and Experimental Nephrology 2024-03-04 [PMID: 38436899]
• Wang Y, Wang W, Yang X et al. ITGA8 positive cells in the conventional outflow tissue exhibit Schlemm's canal endothelial cell properties Life sciences 2021-05-04 [PMID: 33961857] (IF/IHC, Human)
• Magnussen SN, Toraskar J, Wilhelm I, Hasko J et Al. Nephronectin promotes breast cancer brain metastatic colonization via its integrin-binding domains Sci Rep 2020-07-24 [PMID: 32699247]

Bioinformatics

• Gene Symbol: ITGA8
• Entrez:
  • 8516(Human)
• Uniprot:
  • P53708()