KLF8 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: KLF8 Antibody [NBP2-57740] - Staining of human cell line RT4 shows localization to nucleoplasm & aggresome.
Immunocytochemistry/ Immunofluorescence: KLF8 Antibody [NBP2-57740] - DANCR knockdown blocked the tumor formation in vivo involving KLF8 activation. CAL-27 or TCa-8113 cells transfected with shRNA against DANCR were ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KLF8 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PALFNDIKIEPPEELLASDFSLPQVEPVDLSFHKPKAPLQPASMLQAPIRPPKPQSSPQ
Specificity
Specificity of human KLF8 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KLF8
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry-Paraffin
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. Use in IHC-P reported in scientific literature (PMID:31827393).
Control Peptide
KLF8 Recombinant Protein Antigen (NBP2-57740PEP)
Publications
Read Publication using
NBP2-57740 in the following applications:

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 31827393).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for KLF8 Antibody

  • Basic krueppel-like factor 3
  • basic kruppel-like factor 3
  • BKLF3DKFZp686O08126
  • DXS741
  • Krueppel-like factor 8
  • Kruppel-like factor 8
  • Zinc finger protein 741
  • ZNF741MGC138314

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-48937
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37380
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready
NBP2-75453
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-67327
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
MMP200
Species: Hu, Mu, Rt, Po, Ca
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
DPSG10
Species: Hu
NB600-233
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-P, IP, CHIP-SEQ
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-03886
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NBP1-82991
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, KD
NBP2-67416
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, Flow, ICC/IF, IP, In vitro, Flow-IC
NBP1-69368
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24749
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-37578
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP1-05987
Species: Hu, Mu, Rt
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP, MiAr, ChIP, KD, Single-Cell Western
MAB9097
Species: Hu
Applications: ICC, ICFlow

Publications for KLF8 Antibody (NBP2-57740)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: IHC-P.


Filter By Application
IHC-P
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for KLF8 Antibody (NBP2-57740) (0)

There are no reviews for KLF8 Antibody (NBP2-57740). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for KLF8 Antibody (NBP2-57740) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional KLF8 Products

Bioinformatics Tool for KLF8 Antibody (NBP2-57740)

Discover related pathways, diseases and genes to KLF8 Antibody (NBP2-57740). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KLF8 Antibody (NBP2-57740)

Discover more about diseases related to KLF8 Antibody (NBP2-57740).
 

Pathways for KLF8 Antibody (NBP2-57740)

View related products by pathway.

PTMs for KLF8 Antibody (NBP2-57740)

Learn more about PTMs related to KLF8 Antibody (NBP2-57740).

Blogs on KLF8

There are no specific blogs for KLF8, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KLF8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KLF8