KLF8 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: KLF8 Antibody [NBP2-57740] - Staining of human cell line RT4 shows localization to nucleoplasm & aggresome.

Immunocytochemistry/Immunofluorescence: KLF8 Antibody [NBP2-57740] - DANCR knockdown blocked the tumor formation in vivo involving KLF8 activation. CAL-27 or TCa-8113 cells transfected with shRNA against DANCR were inoculated subcutaneously into the nude mice. Xenografts were measured every 4 days with a caliper. Immunofluorescence staining was performed to investigate KLF8 immunoreactive materials in tumor tissues after 25 days. ***p < 0.001, versus to sh-NC Image collected and cropped by CiteAb from the following publication (//cancerci.biomedcentral.com/articles/10.1186/s12935-019-1016-6), licensed under a CC-BY license.

Western Blot: KLF8 Antibody [NBP2-57740] - MiR-135a-5p overexpression suppressed tumor cell progression & KLF8 expression in vitro. a Relative expression of miR-135a-5p in different TSCC cell lines was examined using qRT-PCR. b Relative expression of miR-135a-5p was measured in CAL-27 & TCa-8113 cells transfected with miR-135a-5p mimics by qRT-PCR. c The viability of CAL-27 & TCa-8113 cells was measured using MTT assay. d, e The migration & invasion of CAL-27 & TCa-8113 cells was examined using wound healing assay & transwell assay, respectively. f Relative expression of KLF8 mRNA was detected in CAL-27 & TCa-8113 cells using qRT-PCR. g Relative expression of KLF8 protein was measured using western blot in CAL-27 & TCa-8113 cells. *p < 0.05, **p < 0.01, ***p < 0.001, versus to NC mimics Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31827393), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Western Blot: KLF8 Antibody [NBP2-57740] - DANCR knockdown repressed tumor cell progression & KLF8 expression by targeting miR-135a-5p in vitro. a The viability of CAL-27 & TCa-8113 cells was measured using MTT assay. b, c The migration & invasion of CAL-27 & TCa-8113 cells were detected by wound healing assay & transwell assay, respectively. d Relative expression of MMP-2 & MMP-9 protein was determined by western blot in CAL-27 & TCa-8113 cells. e Relative expression of KLF8 protein was detected using western blot in CAL-27 & TCa-8113 cells. *p < 0.05, **p < 0.01, ***p < 0.001, versus to si-NC; &p < 0.05, &&p < 0.01, &&&p < 0.001, versus to si-DANCR-1 + NC inhibitor Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31827393), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

DANCR knockdown blocked the tumor formation in vivo involving KLF8 activation. CAL-27 or TCa-8113 cells transfected with shRNA against DANCR were inoculated subcutaneously into the nude mice. Xenografts were measured every 4 days with a caliper. a Tumor volumes were measured every 4 days. b Mice were sacrificed after 25 days, and xenograft tumors were excised and weighed. c Relative expression of MMP-2 and MMP-9 protein in tumor tissues was measured by western blot after 25 days. d Relative expression of KLF8 protein in tumor tissues was examined by western blot after 25 days. e Immunofluorescence staining was performed to investigate KLF8 immunoreactive materials in tumor tissues after 25 days. ***p < 0.001, versus to sh-NC Image collected and cropped by CiteAb from the following open publication (//pubmed.ncbi.nlm.nih.gov/31827393), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

ChIP-Exo-Seq composite graph for Anti-KLF8 tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh's Lab at Cornell University.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

KLF8 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PALFNDIKIEPPEELLASDFSLPQVEPVDLSFHKPKAPLQPASMLQAPIRPPKPQSSPQ
• Predicted Species: Rat (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KLF8
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry-Paraffin Use in IHC-P reported in scientific literature (PMID:31827393).
  • Western Blot Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/31827393), licensed under a CC-BY licence.
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  KLF8 Recombinant Protein Antigen (NBP2-57740PEP)

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 31827393).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for KLF8 Antibody - BSA Free

• Basic krueppel-like factor 3
• basic kruppel-like factor 3
• BKLF3DKFZp686O08126
• DXS741
• Krueppel-like factor 8
• Kruppel-like factor 8
• Zinc finger protein 741
• ZNF741MGC138314

Background

The KLF8 gene encodes a protein which is a member of the Sp/KLF family of transcription factors. Members of this family contain a C-terminal DNA-binding domain with three Kruppel-like zinc fingers. The encoded protein is thought to play an important role in t

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for KLF8 Antibody (NBP2-57740)(1)

Publication using NBP2-57740

• Zheng Y, Zheng B, Meng X et al. LncRNA DANCR promotes the proliferation, migration, and invasion of tongue squamous cell carcinoma cells through miR-135a-5p/KLF8 axis Cancer Cell Int 2019-12-01 [PMID: 31827393] (IHC-P, Mouse)

Bioinformatics

• Gene Symbol: KLF8