Home » KLF8 » KLF8 Antibodies » KLF8 Antibody

KLF8 Antibody

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Immunocytochemistry/Immunofluorescence: KLF8 Antibody [NBP2-57740] - Staining of human cell line RT4 shows localization to nucleoplasm & aggresome.
Immunocytochemistry/ Immunofluorescence: KLF8 Antibody [NBP2-57740] - Staining of human cell line RT4 shows localization to nucleoplasm & aggresome.
Immunocytochemistry/ Immunofluorescence: KLF8 Antibody [NBP2-57740] - DANCR knockdown blocked the tumor formation in vivo involving KLF8 activation. CAL-27 or TCa-8113 cells transfected with shRNA against DANCR were ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

KLF8 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PALFNDIKIEPPEELLASDFSLPQVEPVDLSFHKPKAPLQPASMLQAPIRPPKPQSSPQ
Specificity
Specificity of human KLF8 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KLF8
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry-Paraffin
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. Use in IHC-P reported in scientific literature (PMID:31827393).
Control Peptide
KLF8 Recombinant Protein Antigen (NBP2-57740PEP)
Publications
Read Publication using
NBP2-57740 in the following applications:

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 31827393).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for KLF8 Antibody

  • Basic krueppel-like factor 3
  • basic kruppel-like factor 3
  • BKLF3DKFZp686O08126
  • DXS741
  • Krueppel-like factor 8
  • Kruppel-like factor 8
  • Zinc finger protein 741
  • ZNF741MGC138314

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Cyclin D1 Antibody
(SPM587)
NBP2-32840
Western Blot: Cyclin D1 Antibody (SPM587) [NBP2-32840] - HELLS expression and protein levels are modulated with YAP1/TEAD inhibition downstream of SHH signaling. Western blot showing protein levels of HELLS, cleaved caspase 3 (CC3), and Cyclin D1 in verteporfin treated CGNPs. Blot is representative of three replicates. Full-length blots are presented in Supplementary Fig. S4. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41598-019-50088-1), licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: Cyclin D1 Antibody (SPM587) [NBP2-32840] - Formalin-paraffin human Mantle Cell Lymphoma stained with Cyclin D1 Ab (Clone SPM587).
Western Blot: Cyclin D1 Antibody (SPM587) [NBP2-32840] - analysis of Cyclin D1 in human breast cancer cell line MDA-MB-231 cell lysate using anti-Cyclin D1. Image from verified customer review.
(1 Review)
(5 Publications)
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
KLF3 Antibody
NBP2-48937
Western Blot: KLF3 Antibody [NBP2-48937] - Analysis in human cell line K562.
Immunocytochemistry/Immunofluorescence: KLF3 Antibody [NBP2-48937] - Staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: KLF3 Antibody [NBP2-48937] - Staining of human skin shows strong nuclear positivity in squamous epithelial cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
KLF1 Antibody
(1B6A3)
NBP2-37380
Western Blot: KLF1 Antibody (1B6A3) [NBP2-37380] - Western blot analysis using KLF1 mAb against human KLF1 recombinant protein. (Expected MW is 42.6 kDa)
Immunohistochemistry: KLF1 Antibody (1B6A3) [NBP2-37380] - Immunohistochemical analysis of paraffin-embedded rectum cancer tissues using KLF1 mouse mAb with DAB staining.
Flow Cytometry: KLF1 Antibody (1B6A3) [NBP2-37380] - Flow cytometric analysis of HeLa cells using KLF1 mouse mAb (green) and negative control (red).
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready
CtBP1 Antibody
(JG39-73)
NBP2-75453
Western Blot: CtBP1 Antibody (JG39-73) [NBP2-75453] - Analysis of CtBP1 on PC-3M cell lysate using anti-CtBP1 antibody at 1/1,000 dilution.
Immunocytochemistry/Immunofluorescence: CtBP1 Antibody (JG39-73) [NBP2-75453] - Staining CtBP1 in A549 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: CtBP1 Antibody (JG39-73) [NBP2-75453] - Analysis of paraffin-embedded rat kidney tissue using anti-CtBP1 antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
FAK Antibody
(SR46-04)
NBP2-67327
Western Blot: FAK Antibody (SR46-04) [NBP2-67327] - Analysis of FAK on different lysates using anti-FAK antibody at 1/1,000 dilution. Positive control: Lane 1: Hela Lane 2: Mouse spleen
Immunocytochemistry/Immunofluorescence: FAK Antibody (SR46-04) [NBP2-67327] - Staining FAK in PANC-1 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: FAK Antibody (SR46-04) [NBP2-67327] - Analysis of paraffin-embedded huamn liver cancer tissue using anti-FAK antibody. Counter stained with hematoxylin.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
MMP-2 [HRP]
MMP200
(1 Review)
(61 Publications)
Species: Hu, Mu, Rt, Po, Ca
COCO/DAND5
Antibody (OTI2H3)
NBP2-01223
Western Blot: DAND5 Antibody (2H3) [NBP2-01223] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY DAND5 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-DAND5.
Immunohistochemistry-Paraffin: DAND5 Antibody (2H3) [NBP2-01223] Staining of paraffin-embedded Carcinoma of Human bladder tissue using anti-DAND5 mouse monoclonal antibody.
Flow Cytometry: DAND5 Antibody (2H3) [NBP2-01223] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-DAND5 antibody, and then analyzed by flow cytometry.
Species: Hu
Applications: WB, Flow, IHC, IHC-P
PSG1 [HRP]
DPSG10
(2 Publications)
Species: Hu
SP1 Antibody
NB600-233
Western Blot: SP1 Antibody [NB600-233] - Samples: Whole cell lysate (50 ug) from HeLa, 293T, and mouse Renca cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-SP1 antibody used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 10 seconds.
Immunohistochemistry-Paraffin: SP1 Antibody [NB600-233] - Mouse renal cell carcinoma. Antibody: Affinity purified rabbit anti-SP1 used at a dilution of 1:5,000 (0.2ug/ml). Detection: DAB
Chromatin Immunoprecipitation: SP1 Antibody [NB600-233] - Chromatin from acute myeloid leukemia cell line was immunoprecipitated with anti-Sp1 antibody and analyzed by DNA sequencing. The figure illustrates the peak distribution of Sp1 binding within a 250 Kb region of chromosome 6 asdetected using anti-Sp1.
(4 Publications)
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-P, IP, CHIP-SEQ
E-Cadherin
Antibody [Unconjugate
AF748
E‑Cadherin was detected in immersion fixed D3 mouse embryonic stem cell line using Goat Anti-Human/MouseE‑Cadherin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF748) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to cell surfaces. View our protocol for Fluorescent ICC Staining of Stem Cells on Coverslips.
E‑Cadherin was detected in perfusion fixed frozen sections of mouse skin using Goat Anti-Human/Mouse E‑Cadherin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF748) at 1.7 µg/mL overnight at 4 °C. Tissue was stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to plasma membranes in keratinocytes. View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
E‑Cadherin was detected in immersion fixed mouse intestinal organoids using Goat Anti-Human/Mouse E‑Cadherin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF748) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (green; Catalog # NL001) and counterstained with DAPI (blue). Magnification shown at 100X (upper panel) and 40X (lower panel). Specific staining was localized to cell surfaces. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(7 Reviews)
(34 Publications)
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
MMP-9 [HRP]
DMP900
(7 Reviews)
(164 Publications)
Species: Hu
Slug Antibody
(OTI1A6)
NBP2-03886
Western Blot: SLUG Antibody (1A6) [NBP2-03886] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY SLUG (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-SLUG.
Immunohistochemistry-Paraffin: Slug Antibody (1A6) [NBP2-03886] - Mouse glioma stained with Slug antibody. Image from verified customer review.
Flow Cytometry: SLUG Antibody (1A6) [NBP2-03886] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-SLUG antibody, and then analyzed by flow cytometry.
(1 Review)
(5 Publications)
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
ZEB2 Antibody
NBP1-82991
Western Blot: ZEB2 Antibody [NBP1-82991] - Depletion of TRIM14 increased ZEB2 polyubiquitination and proteasomal degradation. Western blot analysis of TRIM14, ZEB2 and beta-actin in LN229 and U251 cells transduced with the indicated shRNA in the absence or presence of 10uM MG132. Image collected and cropped by CiteAb from the following publication (https://jeccr.biomedcentral.com/articles/10.1186/s13046-019-1070-x), licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: ZEB2 Antibody [NBP1-82991] - Staining of human pancreas shows no positivity as expected.
Western Blot: ZEB2 Antibody [NBP1-82991] - Analysis in human cell lines SK-MEL-30 and Caco-2 using Anti-ZEB2 antibody. Corresponding ZEB2 RNA-seq data are presented for the same cell lines. Loading control: Anti-HDAC1.
(2 Reviews)
(19 Publications)
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, KD
Integrin beta
3/CD61 Antibody (SJ19
NBP2-67416
Western Blot: Integrin beta 3/CD61 Antibody (SJ19-09) [NBP2-67416] - Analysis of Integrin beta 3 on different lysates. Proteins were transferred to a PVDF membrane and blocked with 5% BSA in PBS for 1 hour at room temperature. The primary antibody (1/500) was used in 5% BSA at room temperature for 2 hours. Goat Anti-Rabbit IgG - HRP Secondary Antibody at 1:5,000 dilution was used for 1 hour at room temperature. Positive control: Lane 1: HUVEC cell lysateLane 2: mouse marrow tissue lysate
Immunocytochemistry/Immunofluorescence: Integrin beta 3/CD61 Antibody (SJ19-09) [NBP2-67416] - Staining Integrin beta 3 in HepG2 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilized with 0.25% Triton X-100/PBS.
Immunohistochemistry-Paraffin: Integrin beta 3/CD61 Antibody (SJ19-09) [NBP2-67416] - Mouse lung tissue. IF-stained paraffin section. Image from verified customer review.
(2 Reviews)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
KAT3B/p300
Antibody (RW105)
NB100-616
Immunocytochemistry/Immunofluorescence: KAT3B/p300 Antibody (RW105) [NB100-616] - HeLa cells were fixed in 4% paraformaldehyde for 10 min and permeabilized in 0.05% Triton X-100 in PBS for 5 minutes. The cells were incubated with anti-KAT3B Antibody (RW105)) at 5ug/ml for 60 minutes at room temperature and detected with an anti-mouse Dylight 488 (Green) at a 1:1000 dilution for 60 minutes. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 100X objective.
Western Blot: KAT3B/p300 Antibody (RW105) [NB100-616] - p300 detected in a HeLa nuclear extract using NB 100-616 (1:250). ECL: 20 minute exposure.
Flow Cytometry: KAT3B/p300 Antibody (RW105) [NB100-616] - An intracellular stain was performed on RAW 246.7 cells with KAT3B/p300 antibody (RW105) NB100-616PE (blue) and a matched isotype control NBP2-27287PE (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Phycoerythrin. Image using the PE format of this antibody.
(9 Publications)
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, Flow, ICC/IF, IP, In vitro, Flow-IC
SLC22A3 Antibody
NBP1-69368
Western Blot: SLC22A3 Antibody [NBP1-69368] - This Anti-SLC22A3 antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 0.5ug/ml.
Immunohistochemistry: SLC22A3 Antibody [NBP1-69368] - Human kidney
Species: Hu
Applications: WB, IHC, IHC-P
KLF4 Antibody
NBP2-24749
Immunohistochemistry: KLF4 Antibody [NBP2-24749] - DAB IHC staining. Representative 3,3-diaminobenzidine immunohistochemical-stained images showing protein expression of induced-pluripotent stem cell marker KLF4 (J-L, brown) in normal colon (J), low-grade (K) and high-grade (L) colon adenocarcinoma tissue samples. Nuclei were counter-stained with hematoxylin (A-O, blue). Original magnification: 400x. Image collected and cropped by CiteAb from the following publication (//doi.org/10.1371/journal.pone.0221963) licensed under a CC-BY licence.
Western Blot: KLF4 Antibody [NBP2-24749] - Total protein from Human PC3, Hek293 and Mouse Neuro2A cells was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-KLF4 in 1% non-fat milk in TBST and detected with an anti-rabbit HRP secondary antibody using chemiluminescence.
Immunohistochemistry: KLF4 Antibody [NBP2-24749] - IF IHC staining. Representative immunofluorescence immunohistochemical-stained images showing protein expression of induced-pluripotent stem cell markers OCT4 (A-C, green), KLF4 (A-C, red) in normal colon (A), low-grade (B) and high-grade (C) colon adenocarcinoma tissue samples. Cell nuclei were counter-stained with 4', 6'-diamidino-2-phenylindole (A-C, blue). Original magnification: 400x. Image collected and cropped by CiteAb from the following publication (//doi.org/10.1371/journal.pone.0221963) licensed under a CC-BY licence.
(1 Review)
(19 Publications)
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
ITK Antibody (5G6)
NBP2-37578
Western Blot: ITK Antibody (5G6) [NBP2-37578] - Analysis using ITK mouse mAb against Jurkat cell lysate.
Immunocytochemistry/Immunofluorescence: ITK Antibody (5G6) [NBP2-37578] - Immunofluorescence analysis of Jurkat cells using ITK mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye.
Flow Cytometry: ITK Antibody (5G6) [NBP2-37578] - Analysis of Jurkat cells using ITK mouse mAb (blue) and negative control (red).
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
ZEB1 Antibody
NBP1-05987
Immunohistochemistry: ZEB1 Antibody [NBP1-05987] - Immunohistochemical staining results of EMT regulators in HG-PanIN: SNAIL, SLUG, TWIST1, and ZEB1. We categorized and defined three grades: grade 0, <10% positive staining; grade 1, 10%-50% positive; grade 2, 50%< positive Image collected and cropped by CiteAb from the following publication (https://onlinelibrary.wiley.com/doi/abs/10.1002/cam4.2016) licensed under a CC-BY licence.
Western Blot: ZEB1 Antibody [NBP1-05987] - Samples: Whole cell lysate (15 ug) from HeLa, HEK293T, Jurkat, mouse TCMK-1, and mouse NIH 3T3 cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-ZEB1 antibody (NBP1-05987) used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.
Immunohistochemistry-Paraffin: ZEB1 Antibody [NBP1-05987] - Sample: FFPE section of human breast carcinoma. Antibody: Affinity purified rabbit anti-ZEB1 (NBP1-05987) used at a dilution of 1:1000 (0.2 ug/ml). Detection: DAB.
(6 Reviews)
(62 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP, MiAr, ChIP, KD, Single-Cell Western
KLF12 Antibody
(1230C) [Unconjugated
MAB9097
KLF12 was detected in immersion fixed HEK293 human embryonic kidney cell line using Rabbit Anti-Human KLF12 Antigen Affinity-purified Monoclonal Antibody (Catalog # MAB9097) at 2 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Rabbit IgG Secondary Antibody (red; Catalog # NL004) and counterstained with DAPI (blue). Specific staining was localized to nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
MG‑63 human osteosarcoma cell line was stained with Rabbit Anti-Human KLF12 Monoclonal Antibody (Catalog # MAB9097, filled histogram) or isotype control antibody (Catalog # AB-105-C, open histogram), followed by Allophycocyanin-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # F0111). To facilitate intracellular staining, cells were fixed and permeabilized with FlowX FoxP3 Fixation & Permeabilization Buffer Kit (Catalog # FC012). View our protocol for Staining Intracellular Molecules.
Species: Hu
Applications: ICC, ICFlow

Publications for KLF8 Antibody (NBP2-57740)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: IHC-P.


Filter By Application
IHC-P
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for KLF8 Antibody (NBP2-57740) (0)

There are no reviews for KLF8 Antibody (NBP2-57740). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for KLF8 Antibody (NBP2-57740) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional KLF8 Products

Bioinformatics Tool for KLF8 Antibody (NBP2-57740)

Discover related pathways, diseases and genes to KLF8 Antibody (NBP2-57740). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KLF8 Antibody (NBP2-57740)

Discover more about diseases related to KLF8 Antibody (NBP2-57740).
 

Pathways for KLF8 Antibody (NBP2-57740)

View related products by pathway.

PTMs for KLF8 Antibody (NBP2-57740)

Learn more about PTMs related to KLF8 Antibody (NBP2-57740).

Blogs on KLF8

There are no specific blogs for KLF8, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KLF8 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol KLF8