GEM Antibody


Western Blot: GEM Antibody [NBP1-58906] - Human Stomach Tumor cell lysate. Antibody at 1.0 ug/mL.
Immunohistochemistry: GEM Antibody [NBP1-58906] - Human kidney tissue section. Magnification: 400X.
Western Blot: GEM Antibody [NBP1-58906] - HepG2 cell lysate. Antibody at 2.5 ug/mL.
Immunohistochemistry-Paraffin: GEM Antibody [NBP1-58906] - Human Skin Cellular Data: Squamous epithelial tissue section. Magnification: 400X.

Product Details

Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC
1 mg/ml

Order Details

GEM Antibody Summary

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Synthetic peptides corresponding to GEM(GTP binding protein overexpressed in skeletal muscle) The peptide sequence was selected from the C terminal of GEM (NP_005252). Peptide sequence ETSAAVQHNVKELFEGIVRQVRLRRDSKEKNERRLAYQKRKESMPRKARRFW The peptide sequence for this immunogen was taken from within the described region.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry 1:10 - 1:500
  • Immunohistochemistry-Frozen
  • Immunohistochemistry-Paraffin 4 - 8 ug/mL
  • Western Blot 1.0 ug/ml
Application Notes
Use in Immunocytochemistry/immunofluorescence and Immunohistochemistry-Frozen reported in scientific literature (PMID 24809506).
Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Reviewed Applications
Read 1 Review rated 4
NBP1-58906 in the following applications:

Read Publications using
NBP1-58906 in the following applications:

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 24809506).

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, 2% Sucrose
0.09% Sodium Azide
1 mg/ml
Protein A purified

Alternate Names for GEM Antibody

  • GTP binding protein overexpressed in skeletal muscle
  • GTP-binding mitogen-induced T-cell protein
  • GTP-binding protein GEM
  • GTP-binding protein overexpressed in skeletal muscle
  • kinase-inducible Ras-like protein
  • KIRMGC26294
  • RAS-like protein KIR


GEM belongs to the RAD/GEM family of GTP-binding proteins. It is associated with the inner face of the plasma membrane and could play a role as a regulatory protein in receptor-mediated signal transduction.The protein encoded by this gene belongs to the RAD/GEM family of GTP-binding proteins. It is associated with the inner face of the plasma membrane and could play a role as a regulatory protein in receptor-mediated signal transduction. Alternative splicing occurs at this locus and two transcript variants encoding the same protein have been identified.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for GEM Antibody (NBP1-58906)(2)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 3 applications: ICC/IF, IHC-Fr, WB.

Filter By Application
All Applications
Filter By Species
All Species

Review for GEM Antibody (NBP1-58906) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP1-58906:
Filter by Applications
All Applications
Filter by Species
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry-Frozen GEM NBP1-58906
reviewed by:
Valeria Di Leo
IHC-Fr Human 11/05/2020


Sample TestedSkeletal muscle tissue,Skeletal muscle


CommentsFixative: 4% paraformaldehyde
Permeabilization: Methanol gradient (70% for 10 mins, 95% for 10 mins, 100% for 20 mins, 95% for 10 mins, 70% for 10 mins)
Protein blocking: 10% NGS diluted in TBST
Endogenous biotin blocking: Avidin D solution for 15 mins, Biotin for 15 mins (Vector Laboratories, Inc)
Dilution: 1/50
Incubation time: 19 hour(s) and 0 minute(s) · Diluent TBST – NGS 10%
Secondary antibody: Life tech/ThermoFisher, A11006, Alexa 488, anti-Rabbit isotype IgG, Host species: Goat, Clonality: Polyclonal

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GEM Antibody (NBP1-58906) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional GEM Products

Research Areas for GEM Antibody (NBP1-58906)

Find related products by research area.

Blogs on GEM

There are no specific blogs for GEM, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Recent Reviews


Valeria Di Leo
Application: IHC-Fr
Species: Human


Gene Symbol GEM