GEM Antibody

Images

 
Western Blot: GEM Antibody [NBP1-58906] - Sample Tissue: Human Stomach Tumor Antibody Dilution: 1.0 ug/ml
Immunohistochemistry: GEM Antibody [NBP1-58906] - Paraffin Embedded Tissue: Human Kidney Cellular Data: Epithelial cells of renal tubule Antibody Concentration: 4.0 - 8.0 ug/ml Magnification: 400X
Western Blot: GEM Antibody [NBP1-58906] - Titration: 2.5ug/ml Positive Control: HepG2 cell lysate.
Immunohistochemistry-Paraffin: GEM Antibody [NBP1-58906] - Human Skin Cellular Data: Squamous epithelial cells Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Eq, GP, RbSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-Fr, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GEM Antibody Summary

Immunogen
Synthetic peptides corresponding to GEM(GTP binding protein overexpressed in skeletal muscle) The peptide sequence was selected from the C terminal of GEM (NP_005252). Peptide sequence FSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFSLVARKL.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GEM
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 2.5 ug/ml
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Frozen
  • Immunohistochemistry-Paraffin 4-8 ug/ml
Application Notes
This is a rabbit polyclonal antibody against GEM and was validated on Western Blot and immunohistochemistry-paraffin Use in Immunocytochemistry/immunofluorescence and Immunohistochemistry-Frozen reported in scientific literature (PMID 24809506)
Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publications using
NBP1-58906 in the following applications:

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 24809506).

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for GEM Antibody

  • GTP binding protein overexpressed in skeletal muscle
  • GTP-binding mitogen-induced T-cell protein
  • GTP-binding protein GEM
  • GTP-binding protein overexpressed in skeletal muscle
  • kinase-inducible Ras-like protein
  • KIRMGC26294
  • RAS-like protein KIR

Background

GEM belongs to the RAD/GEM family of GTP-binding proteins. It is associated with the inner face of the plasma membrane and could play a role as a regulatory protein in receptor-mediated signal transduction.The protein encoded by this gene belongs to the RAD/GEM family of GTP-binding proteins. It is associated with the inner face of the plasma membrane and could play a role as a regulatory protein in receptor-mediated signal transduction. Alternative splicing occurs at this locus and two transcript variants encoding the same protein have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-61872
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P
NBP2-50419
Species: Hu
Applications: Flow, IP, CyTOF-ready
MAB1058
Species: Hu
Applications: Flow, Block, CyTOF-ready
MAB2014
Species: Hu
Applications: Flow, CyTOF-reported
NB100-56618
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, Flow-CS
MAB1059
Species: Hu
Applications: Flow, CyTOF-ready
H00003126-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
MAB12251
Species: Hu
Applications: Flow, CyTOF-ready
MAB1844
Species: Hu
Applications: Flow, CyTOF-reported
MAB8887
Species: Hu
Applications: Flow
MAB2238
Species: Hu
Applications: Flow, AgAct, CyTOF-reported
NBP1-82874
Species: Hu, Rt
Applications: IHC, IHC-P
NBP2-45041
Species: Hu, Po
Applications: Flow, IHC, IHC-Fr, IF
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-87709
Species: Hu
Applications: IHC, IHC-P
NBP1-58864
Species: Hu, Mu, Rt, Bv, Ca, GP, Rb
Applications: WB
NB120-6405
Species: Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N, CyTOF-ready, Flow-IC
NBP1-58906
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-58906
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for GEM Antibody (NBP1-58906)(2)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 3 applications: ICC/IF, IHC-Fr, WB.


Filter By Application
ICC/IF
(1)
IHC-Fr
(1)
WB
(2)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for GEM Antibody (NBP1-58906) (0)

There are no reviews for GEM Antibody (NBP1-58906). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GEM Antibody (NBP1-58906) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional GEM Products

Bioinformatics Tool for GEM Antibody (NBP1-58906)

Discover related pathways, diseases and genes to GEM Antibody (NBP1-58906). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GEM Antibody (NBP1-58906)

Discover more about diseases related to GEM Antibody (NBP1-58906).
 

Pathways for GEM Antibody (NBP1-58906)

View related products by pathway.

PTMs for GEM Antibody (NBP1-58906)

Learn more about PTMs related to GEM Antibody (NBP1-58906).
 

Research Areas for GEM Antibody (NBP1-58906)

Find related products by research area.

Blogs on GEM

There are no specific blogs for GEM, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GEM Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GEM
Entrez
Uniprot