IL-7 Antibody - BSA Free

Immunohistochemistry-Paraffin: IL-7 Antibody [NBP1-83111] - Staining of human lymph node shows moderate cytoplasmic and membranous positivity in non-germinal center cells.

Immunohistochemistry-Paraffin: IL-7 Antibody [NBP1-83111] - Staining of human stomach shows strong cytoplasmic and membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: IL-7 Antibody [NBP1-83111] - Staining of human small intestine shows strong cytoplasmic and membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: IL-7 Antibody [NBP1-83111] - Staining of human skin shows strong cytoplasmic and membranous positivity in squamous epithelial cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

IL-7 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit IL-7 Antibody - BSA Free (NBP1-83111) is a polyclonal antibody validated for use in IHC. Anti-IL-7 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEI
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: IL7
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  IL-7 Protein (NBP1-83111PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for IL-7 Antibody - BSA Free

• IL7
• IL-7
• IL-7interleukin-7
• interleukin 7
• Lymphopoietin-1
• PBGF

Background

Interleukin-7 (IL-7, previously known as lymphopoietin-1 and pre-B-cell growth factor) is a hematopoietic growth factor that stimulates early B and T cells. It can also co-stimulate the proliferation of mature T cells with other factors such as ConA (concanavalin A) and IL-2. IL-7 can induce the formation of lymphokine-activated killer (LAK) cells, it also plays a role in the development of cytotoxic T lymphocytes (CTL). IL-7 can stimulate the production of pro-inflammatory cytokines and enhance the tumoricidal activity of monocytes/macrophages. It is produced by thymic stromal cells, spleen cells and keratinocytes. Human and murine IL-7 show cross-species reactivity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for IL-7 Antibody (NBP1-83111)(1)

Publication using NBP1-83111

• Bachmann J, Burte F, Pramana S et al. Affinity Proteomics Reveals Elevated Muscle Proteins in Plasma of Children with Cerebral Malaria. PLoS Pathog 2014-04-01 [PMID: 24743550]

Bioinformatics

• Gene Symbol: IL7