HDAC5 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: HDAC5 Antibody [NBP1-83436] - Immunofluorescent staining of human cell line A-431 shows localization to nuclear speckles, cytosol & the Golgi apparatus.
Immunohistochemistry-Paraffin: HDAC5 Antibody [NBP1-83436] - Staining of human cerebellum shows moderate cytoplasmic and nuclear positivity in Purkinje cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HDAC5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:THPEETEEELTEQQEVLLGEGALTMPREGSTESESTQEDLEEEDEEDDGEEEEDCIQVKDEEGESGAEEGPDLEEPGAGYKKLFSDAQP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HDAC5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
HDAC5 Protein (NBP1-83436PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%), Rat (84%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HDAC5 Antibody

  • Antigen NY-CO-9
  • EC 3.5.1.98
  • FLJ90614
  • HD5
  • histone deacetylase 5
  • KIAA0600
  • NY-CO-9

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-03993
Species: Hu, Bv, Ca, Pm
Applications: WB, IHC, IHC-P
NB100-56341
Species: Hu
Applications: WB, ChIP, IP
NBP1-87789
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00004205-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB100-1669
Species: Hu
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
NB100-56340
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
NB100-56343
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, IP
NBP1-87109
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00493
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-44092
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MAB1364
Species: Hu
Applications: Flow, CyTOF-ready
NBP2-27202
Species: Hu, Mu, Rt, Po, Ca, Ch, ChHa, Fe, Op, Other, Pm
Applications: WB, Simple Western
NBP1-49533
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-58824
Species: Hu, Mu
Applications: WB, ChIP, IP, PLA
NB100-56510
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB110-60002
Species: Hu
Applications: WB, DB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-56511
Species: Hu, Mu, Rt, Fe
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
AF2850
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP1-83436
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for HDAC5 Antibody (NBP1-83436) (0)

There are no publications for HDAC5 Antibody (NBP1-83436).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HDAC5 Antibody (NBP1-83436) (0)

There are no reviews for HDAC5 Antibody (NBP1-83436). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for HDAC5 Antibody (NBP1-83436) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HDAC5 Products

Bioinformatics Tool for HDAC5 Antibody (NBP1-83436)

Discover related pathways, diseases and genes to HDAC5 Antibody (NBP1-83436). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HDAC5 Antibody (NBP1-83436)

Discover more about diseases related to HDAC5 Antibody (NBP1-83436).
 

Pathways for HDAC5 Antibody (NBP1-83436)

View related products by pathway.

PTMs for HDAC5 Antibody (NBP1-83436)

Learn more about PTMs related to HDAC5 Antibody (NBP1-83436).
 

Research Areas for HDAC5 Antibody (NBP1-83436)

Find related products by research area.

Blogs on HDAC5.

SREBP2: From Cholesterol Homeostasis to Cancer Invasion
Sterol-regulatory-element-binding protein 2 (SREBP2) is a transcription factor that regulates cholesterol homeostasis by controlling enzymes involved in cholesterol synthesis and uptake, e.g. HMG-CoA. Along with another transcription factor LXR, SREBP...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HDAC5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HDAC5