HDAC5 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: HDAC5 Antibody [NBP1-83436] - Immunofluorescent staining of human cell line A-431 shows localization to nuclear speckles, cytosol & the Golgi apparatus.

Immunohistochemistry-Paraffin: HDAC5 Antibody [NBP1-83436] - Staining of human skin shows moderate cytoplasmic positivity and strong nuclear positivity in squamous epithelial cells.

Immunohistochemistry-Paraffin: HDAC5 Antibody [NBP1-83436] - Staining of human placenta shows moderate cytoplasmic positivity and strong nuclear positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: HDAC5 Antibody [NBP1-83436] - Staining of human skeletal muscle shows weak cytoplasmic and nuclear positivity in myocytes.

Immunohistochemistry-Paraffin: HDAC5 Antibody [NBP1-83436] - Staining of human cerebellum shows weak cytoplasmic positivity and moderate nuclear positivity in Purkinje cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

HDAC5 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit HDAC5 Antibody - BSA Free (NBP1-83436) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: THPEETEEELTEQQEVLLGEGALTMPREGSTESESTQEDLEEEDEEDDGEEEEDCIQVKDEEGESGAEEGPDLEEPGAGYKKLFSDAQP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HDAC5
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  HDAC5 Protein (NBP1-83436PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (84%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for HDAC5 Antibody - BSA Free

• Antigen NY-CO-9
• EC 3.5.1.98
• FLJ90614
• HD5
• Histone Deacetylase 5
• KIAA0600
• NY-CO-9

Background

In the intact cell, DNA closely associates with histones and other nuclear proteins to form chromatin. The remodeling of chromatin is believed to be a critical component of transcriptional regulation and a major source of this remodeling is brought about by the acetylation of nucleosomal histones. Acetylation of lysine residues in the amino terminal tail domain of histone results in an allosteric change in the nucleosomal conformation and an increased accessibility to transcription factors by DNA. Conversely, the deacetylation of histones is associated with transcriptional silencing. Several mammalian proteins have been identified as nuclear histone acetylases, including GCN5, PCAF(p300/CBP- associated factor), p300/CBP, HAT1 and the TFIID subunit TAF II p250. Mammalian HDAC1 (also designated HD1), HDAC2 (also designated RPD3) and HDAC3-6, have been identified as histone deacetylases.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HDAC5