Western Blot: Histone Deacetylase 2/HDAC2 Antibody [NBP1-87109] - Analysis in mouse cell line NIH-3T3.
Immunocytochemistry/ Immunofluorescence: Histone Deacetylase 2/HDAC2 Antibody [NBP1-87109] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus.
Immunohistochemistry-Paraffin: Histone Deacetylase 2/HDAC2 Antibody [NBP1-87109] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.
Genetic Strategies: Western Blot: Histone Deacetylase 2/HDAC2 Antibody [NBP1-87109] - Analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-HDAC2 antibody. ...read more
Immunohistochemistry-Paraffin: Histone Deacetylase 2/HDAC2 Antibody [NBP1-87109] - Staining of human Fallopian tube shows strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: Histone Deacetylase 2/HDAC2 Antibody [NBP1-87109] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: Histone Deacetylase 2/HDAC2 Antibody [NBP1-87109] - Staining of human prostate shows moderate nuclear positivity in smooth muscle cells and glandular cells.
This antibody was developed against Recombinant Protein corresponding to amino acids: IACDEEFSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGTKSEQLSNP
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HDAC2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Theoretical MW
55 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified
Alternate Names for Histone Deacetylase 2/HDAC2 Antibody
EC 3.5.1.98
HD2
HDAC2
Histone Deacetylase 2
RPD3
transcriptional regulator homolog RPD3
YAF1
YY1-associated factor 1
Background
Histone deacetylase 2 (HDAC2), or transcriptional regulator homolog RPD3 L1, is highly homologous to the yeast transcription factor RPD3 (reduced potassium dependency 3) gene. As in yeast, human HDA2 is likely to be involved in regulating chromatin structure during transcription. It has been implicated to associate with YY1, a mammalian zinc-finger transcription factor, which negatively regulates transcription by tethering RPD3 to DNA as a cofactor. This process is highly conserved from yeast to human.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Reviews for Histone Deacetylase 2/HDAC2 Antibody (NBP1-87109) (0)
There are no reviews for Histone Deacetylase 2/HDAC2 Antibody (NBP1-87109).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Bioinformatics Tool for Histone Deacetylase 2/HDAC2 Antibody (NBP1-87109)
Discover related pathways, diseases and genes to Histone Deacetylase 2/HDAC2 Antibody (NBP1-87109). Need help?
Read the Bioinformatics Tool Guide for instructions on using this tool.
Diseases for Histone Deacetylase 2/HDAC2 Antibody (NBP1-87109)
Discover more about diseases related to Histone Deacetylase 2/HDAC2 Antibody (NBP1-87109).
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our Histone Deacetylase 2/HDAC2 Antibody and receive a gift card or discount.