Histone Deacetylase 2/HDAC2 Antibody

Images

 
Western Blot: Histone Deacetylase 2/HDAC2 Antibody [NBP1-87109] - Analysis in mouse cell line NIH-3T3.
Immunocytochemistry/ Immunofluorescence: Histone Deacetylase 2/HDAC2 Antibody [NBP1-87109] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus.
Immunohistochemistry-Paraffin: Histone Deacetylase 2/HDAC2 Antibody [NBP1-87109] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.
Genetic Strategies: Western Blot: Histone Deacetylase 2/HDAC2 Antibody [NBP1-87109] - Analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-HDAC2 antibody. ...read more
Immunohistochemistry-Paraffin: Histone Deacetylase 2/HDAC2 Antibody [NBP1-87109] - Staining of human Fallopian tube shows strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: Histone Deacetylase 2/HDAC2 Antibody [NBP1-87109] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: Histone Deacetylase 2/HDAC2 Antibody [NBP1-87109] - Staining of human prostate shows moderate nuclear positivity in smooth muscle cells and glandular cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

   

Order Details

Histone Deacetylase 2/HDAC2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: IACDEEFSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGTKSEQLSNP
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HDAC2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Theoretical MW
55 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
Histone Deacetylase 2/HDAC2 Protein (NBP1-87109PEP)
Publications
Read Publication using
NBP1-87109 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Histone Deacetylase 2/HDAC2 Antibody

  • EC 3.5.1.98
  • HD2
  • HDAC2
  • Histone Deacetylase 2
  • RPD3
  • transcriptional regulator homolog RPD3
  • YAF1
  • YY1-associated factor 1

Background

Histone deacetylase 2 (HDAC2), or transcriptional regulator homolog RPD3 L1, is highly homologous to the yeast transcription factor RPD3 (reduced potassium dependency 3) gene. As in yeast, human HDA2 is likely to be involved in regulating chromatin structure during transcription. It has been implicated to associate with YY1, a mammalian zinc-finger transcription factor, which negatively regulates transcription by tethering RPD3 to DNA as a cofactor. This process is highly conserved from yeast to human.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56340
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
NBP2-03993
Species: Bv, Ca, Hu, Mu, Pm
Applications: WB
NB100-1669
Species: Hu
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NBP2-07996
Species: Hu
Applications: WB
NBP2-52486
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB500-171
Species: Hu, I, Mu, Rt, Xp, Ye
Applications: ChIP, IB, ICC/IF, IHC, IHC-P, Single-Cell Western, WB
H00007001-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
NLS3775
Species: Hu, Pm
Applications: ICC/IF, IHC, IHC-P
NBP1-85351
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00008294-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
H00008363-P01
Species: Hu
Applications: ELISA, AP, PA, WB
H00008362-P01
Species: Hu
Applications: ELISA, AP, PA, WB
H00008365-M01
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA
NBL1-11567
Species: Hu
Applications: WB
NB21-2024
Species: Hu, Ma, Mu, Po, Rt
Applications: ChIP, DB, ICC/IF, WB
NBP2-22151
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
MAB2676
Species: Hu, Mu, Rt
Applications: ICC, WB

Publications for Histone Deacetylase 2/HDAC2 Antibody (NBP1-87109)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for Histone Deacetylase 2/HDAC2 Antibody (NBP1-87109) (0)

There are no reviews for Histone Deacetylase 2/HDAC2 Antibody (NBP1-87109). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Histone Deacetylase 2/HDAC2 Antibody (NBP1-87109) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Histone Deacetylase 2/HDAC2 Products

Diseases for Histone Deacetylase 2/HDAC2 Antibody (NBP1-87109)

Discover more about diseases related to Histone Deacetylase 2/HDAC2 Antibody (NBP1-87109).
 

Pathways for Histone Deacetylase 2/HDAC2 Antibody (NBP1-87109)

View related products by pathway.

PTMs for Histone Deacetylase 2/HDAC2 Antibody (NBP1-87109)

Learn more about PTMs related to Histone Deacetylase 2/HDAC2 Antibody (NBP1-87109).
 

Research Areas for Histone Deacetylase 2/HDAC2 Antibody (NBP1-87109)

Find related products by research area.

Blogs on Histone Deacetylase 2/HDAC2

There are no specific blogs for Histone Deacetylase 2/HDAC2, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Histone Deacetylase 2/HDAC2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HDAC2
Entrez
Uniprot