Histone Deacetylase 2/HDAC2 Antibody

Images

 
Western Blot: Histone Deacetylase 2/HDAC2 Antibody [NBP1-87109] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: Histone Deacetylase 2/HDAC2 Antibody [NBP1-87109] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus.
Immunohistochemistry-Paraffin: Histone Deacetylase 2/HDAC2 Antibody [NBP1-87109] - Staining of human cerebral cortex shows strong nuclear and cytoplasmic positivity in neuronal cells.
Western Blot: Histone Deacetylase 2/HDAC2 Antibody [NBP1-87109] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Histone Deacetylase 2/HDAC2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:IACDEEFSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGTKSEQLSNP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HDAC2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Theoretical MW
55 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
Histone Deacetylase 2/HDAC2 Protein (NBP1-87109PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Histone Deacetylase 2/HDAC2 Antibody

  • EC 3.5.1.98
  • HD2
  • HDAC2
  • Histone Deacetylase 2
  • RPD3
  • transcriptional regulator homolog RPD3
  • YAF1
  • YY1-associated factor 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56340
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
NBP2-03993
Species: Hu, Bv, Ca, Pm
Applications: WB, IHC, IHC-P
NB100-1669
Species: Hu
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
NBP2-07996
Species: Hu
NBP2-52486
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
H00007001-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-90058
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85351
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-11569
Species: Hu
H00008360-R01
Species: Hu
NBL1-11570
Species: Hu
NBP2-10888
Species: Hu
H00008365-M01
Species: Hu
Applications: ELISA, ICC/IF
NBL1-11567
Species: Hu
NB21-2024
Species: Hu, Mu, Rt, Ma
Applications: WB, ChIP, DB, ICC/IF
NB100-56341
Species: Hu
Applications: WB, ChIP, IP
NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
NBP1-87109
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Histone Deacetylase 2/HDAC2 Antibody (NBP1-87109) (0)

There are no publications for Histone Deacetylase 2/HDAC2 Antibody (NBP1-87109).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Histone Deacetylase 2/HDAC2 Antibody (NBP1-87109) (0)

There are no reviews for Histone Deacetylase 2/HDAC2 Antibody (NBP1-87109). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Histone Deacetylase 2/HDAC2 Antibody (NBP1-87109) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Histone Deacetylase 2/HDAC2 Products

Bioinformatics Tool for Histone Deacetylase 2/HDAC2 Antibody (NBP1-87109)

Discover related pathways, diseases and genes to Histone Deacetylase 2/HDAC2 Antibody (NBP1-87109). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Histone Deacetylase 2/HDAC2 Antibody (NBP1-87109)

Discover more about diseases related to Histone Deacetylase 2/HDAC2 Antibody (NBP1-87109).
 

Pathways for Histone Deacetylase 2/HDAC2 Antibody (NBP1-87109)

View related products by pathway.

PTMs for Histone Deacetylase 2/HDAC2 Antibody (NBP1-87109)

Learn more about PTMs related to Histone Deacetylase 2/HDAC2 Antibody (NBP1-87109).
 

Research Areas for Histone Deacetylase 2/HDAC2 Antibody (NBP1-87109)

Find related products by research area.

Blogs on Histone Deacetylase 2/HDAC2

There are no specific blogs for Histone Deacetylase 2/HDAC2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Histone Deacetylase 2/HDAC2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HDAC2
Entrez
Uniprot