PKC mu Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: PKC mu Antibody [NBP1-87789] - Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane & cytosol.
Immunohistochemistry-Paraffin: PKC mu Antibody [NBP1-87789] - Staining of human parathyroid gland shows cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PKC mu Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RELECKIGERYITHESDDLRWEKYAGEQGLQYPTHLINPSASHSDTPETEETEMKALGER
Specificity
Specificity of human PKC mu antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PRKD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
IHC reported in scientific literature (PMID: 25240283). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PKC mu Protein (NBP1-87789PEP)
Publications
Read Publication using
NBP1-87789 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%), Rat (83%). Human reactivity reported in scientific literature (PMID: 25240283).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PKC mu Antibody

  • EC 2.7.11
  • nPKC-D1
  • nPKC-mu
  • PKCM
  • PKC-MU
  • PKD1
  • PKDEC 2.7.11.13
  • PRKCMPKC-mu
  • PRKD1
  • Protein kinase C mu type
  • protein kinase C, mu
  • Protein kinase D
  • protein kinase D1
  • serine/threonine-protein kinase D1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-30117
Species: Hu, Mu
Applications: WB, IP
NBP2-02984
Species: Hu, Rt, Ca, Pm, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-82026
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MAB1230
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
BC110-60479
Species: Hu, Mu
Applications: ICC/IF, PEP-ELISA
NBP1-87948
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-22152
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P, ChIP
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-27561
Species: Hu, Rt, Ch
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-14868
Species: Hu, Mu, Eq
Applications: WB, ICC/IF, IHC, IHC-P
MAB40401
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP2-50599
Species: Hu
Applications: WB, ELISA, Flow, IHC, IP, CyTOF-ready
NBP2-03993
Species: Hu, Mu, Bv, Ca, Pm
Applications: WB
NB600-607
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
H00005122-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow

Publications for PKC mu Antibody (NBP1-87789)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for PKC mu Antibody (NBP1-87789) (0)

There are no reviews for PKC mu Antibody (NBP1-87789). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PKC mu Antibody (NBP1-87789) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PKC mu Products

Bioinformatics Tool for PKC mu Antibody (NBP1-87789)

Discover related pathways, diseases and genes to PKC mu Antibody (NBP1-87789). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PKC mu Antibody (NBP1-87789)

Discover more about diseases related to PKC mu Antibody (NBP1-87789).
 

Pathways for PKC mu Antibody (NBP1-87789)

View related products by pathway.

PTMs for PKC mu Antibody (NBP1-87789)

Learn more about PTMs related to PKC mu Antibody (NBP1-87789).
 

Research Areas for PKC mu Antibody (NBP1-87789)

Find related products by research area.

Blogs on PKC mu

There are no specific blogs for PKC mu, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PKC mu Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PRKD1