MEF2A Antibody (1C8)

Images

 
Western Blot: MEF2A Antibody (1C8) [H00004205-M15] - Analysis of MEF2A expression in HepG2 (Cat # L019V1).
Immunocytochemistry/ Immunofluorescence: MEF2A Antibody (1C8) [H00004205-M15] - Analysis of monoclonal antibody to MEF2A on MCF-7 cell. Antibody concentration 10 ug/ml
Western Blot: MEF2A Antibody (1C8) [H00004205-M15] - Analysis of MEF2A expression in MCF-7 (Cat # L046V1).
ELISA: MEF2A Antibody (1C8) [H00004205-M15] - Detection limit for recombinant GST tagged MEF2A is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
1C8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

MEF2A Antibody (1C8) Summary

Immunogen
MEF2A (AAH13437, 71 a.a. - 170 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EYNEPHESRTNSDIVEALNKKEHRGCDSPDPDTSYVLTPHTEEKYKKINEEFDNMMRNHKIAPGLPPQNFSMSVTVPVTSPNALSYTNPGSSLVSPSLAA
Specificity
MEF2A (1C8)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MEF2A
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MEF2A Antibody (1C8)

  • ADCAD1
  • MADS box transcription enhancer factor 2, polypeptide A (myocyte enhancerfactor 2A)
  • MEF2
  • myocyte enhancer factor 2A
  • myocyte-specific enhancer factor 2A
  • RSRFC4
  • RSRFC9
  • Serum response factor-like protein 1

Background

The process of differentiation from mesodermal precursor cells to myoblasts has led to the discovery of a variety of tissue-specific factors that regulate muscle gene expression. The myogenic basic helix-loop-helix proteins, including myoD (MIM 159970), myogenin (MIM 159980), MYF5 (MIM 159990), and MRF4 (MIM 159991) are one class of identified factors. A second family of DNA binding regulatory proteins is the myocyte-specific enhancer factor-2 (MEF2) family. Each of these proteins binds to the MEF2 target DNA sequence present in the regulatory regions of many, if not all, muscle-specific genes. The MEF2 genes are members of the MADS gene family (named for the yeast mating type-specific transcription factor MCM1, the plant homeotic genes 'agamous' and 'deficiens' and the human serum response factor SRF (MIM 600589)), a family that also includes several homeotic genes and other transcription factors, all of which share a conserved DNA-binding domain.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-00493
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56511
Species: Hu, Mu, Rt, Fe
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP1-85788
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56510
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-33063
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49533
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56341
Species: Hu
Applications: WB, ChIP, IP
NBP2-22152
Species: Hu, Mu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-03993
Species: Hu, Bv, Ca, Pm
Applications: WB, IHC, IHC-P
AF2848
Species: Hu, Mu
Applications: WB, ICC
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-93440
Species: Hu
Applications: IHC, IHC-P
NB500-138
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-44245
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-52030
Species: Hu
Applications: WB, PEP-ELISA
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
H00056731-M02
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for MEF2A Antibody (H00004205-M15) (0)

There are no publications for MEF2A Antibody (H00004205-M15).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MEF2A Antibody (H00004205-M15) (0)

There are no reviews for MEF2A Antibody (H00004205-M15). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MEF2A Antibody (H00004205-M15) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MEF2A Products

Bioinformatics Tool for MEF2A Antibody (H00004205-M15)

Discover related pathways, diseases and genes to MEF2A Antibody (H00004205-M15). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MEF2A Antibody (H00004205-M15)

Discover more about diseases related to MEF2A Antibody (H00004205-M15).
 

Pathways for MEF2A Antibody (H00004205-M15)

View related products by pathway.

PTMs for MEF2A Antibody (H00004205-M15)

Learn more about PTMs related to MEF2A Antibody (H00004205-M15).

Blogs on MEF2A

There are no specific blogs for MEF2A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MEF2A Antibody (1C8) and receive a gift card or discount.

Bioinformatics

Gene Symbol MEF2A
Entrez
OMIM
Uniprot