MEF2A Antibody (1C8)

Images

 
Western Blot: MEF2A Antibody (1C8) [H00004205-M15] - Analysis of MEF2A expression in MCF-7 (Cat # L046V1).
Immunocytochemistry/ Immunofluorescence: MEF2A Antibody (1C8) [H00004205-M15] - Analysis of monoclonal antibody to MEF2A on MCF-7 cell. Image from verified customer review
Western Blot: MEF2A Antibody (1C8) [H00004205-M15] - Analysis of MEF2A expression in HepG2 (Cat # L019V1).
Immunocytochemistry/ Immunofluorescence: MEF2A Antibody (1C8) [H00004205-M15] - Analysis of monoclonal antibody to MEF2A on MCF-7 cell. Antibody concentration 10 ug/ml
ELISA: MEF2A Antibody (1C8) [H00004205-M15] - Detection limit for recombinant GST tagged MEF2A is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
1C8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

MEF2A Antibody (1C8) Summary

Immunogen
MEF2A (AAH13437, 71 a.a. ~ 170 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EYNEPHESRTNSDIVEALNKKEHRGCDSPDPDTSYVLTPHTEEKYKKINEEFDNMMRNHKIAPGLPPQNFSMSVTVPVTSPNALSYTNPGSSLVSPSLAA
Specificity
MEF2A (1C8)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MEF2A
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Western Blot 1:500
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF and ELISA.
Reviewed Applications
Read 1 Review rated 5
using
H00004205-M15 in the following applications:

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MEF2A Antibody (1C8)

  • ADCAD1
  • MADS box transcription enhancer factor 2, polypeptide A (myocyte enhancerfactor 2A)
  • MEF2
  • myocyte enhancer factor 2A
  • myocyte-specific enhancer factor 2A
  • RSRFC4
  • RSRFC9
  • Serum response factor-like protein 1

Background

The process of differentiation from mesodermal precursor cells to myoblasts has led to the discovery of a variety of tissue-specific factors that regulate muscle gene expression. The myogenic basic helix-loop-helix proteins, including myoD (MIM 159970), myogenin (MIM 159980), MYF5 (MIM 159990), and MRF4 (MIM 159991) are one class of identified factors. A second family of DNA binding regulatory proteins is the myocyte-specific enhancer factor-2 (MEF2) family. Each of these proteins binds to the MEF2 target DNA sequence present in the regulatory regions of many, if not all, muscle-specific genes. The MEF2 genes are members of the MADS gene family (named for the yeast mating type-specific transcription factor MCM1, the plant homeotic genes 'agamous' and 'deficiens' and the human serum response factor SRF (MIM 600589)), a family that also includes several homeotic genes and other transcription factors, all of which share a conserved DNA-binding domain.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-17260
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NB100-56511
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, WB
NBP1-85788
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NB100-56510
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-71927
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-49533
Species: Hu, Mu, Pl, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, KD, WB
NBP2-22151
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-22152
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
NBP2-03993
Species: Bv, Ca, Hu, Mu, Pm
Applications: WB
AF2848
Species: Hu, Mu
Applications: ICC, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-67360
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
NBP1-93440
Species: Hu
Applications: IHC, IHC-P
AF8691
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
NBP2-44245
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP1-52030
Species: Hu
Applications: PEP-ELISA, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
H00056731-M02
Species: Hu
Applications: ELISA, ICC/IF, WB
H00004205-M15
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for MEF2A Antibody (H00004205-M15) (0)

There are no publications for MEF2A Antibody (H00004205-M15).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for MEF2A Antibody (H00004205-M15) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using H00004205-M15:
Filter by Applications
Immunocytochemistry
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Immunocytochemistry MEF2A H00004205-M15
Enlarge
5
reviewed by:
Samuel Jones
Immunocytochemistry Human 12/18/2021
View

Summary

ApplicationImmunocytochemistry
Sample TestedMCF-7 cells
SpeciesHuman
Lot1C8

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MEF2A Antibody (H00004205-M15) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MEF2A Products

Bioinformatics Tool for MEF2A Antibody (H00004205-M15)

Discover related pathways, diseases and genes to MEF2A Antibody (H00004205-M15). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MEF2A Antibody (H00004205-M15)

Discover more about diseases related to MEF2A Antibody (H00004205-M15).
 

Pathways for MEF2A Antibody (H00004205-M15)

View related products by pathway.

PTMs for MEF2A Antibody (H00004205-M15)

Learn more about PTMs related to MEF2A Antibody (H00004205-M15).
 

Research Areas for MEF2A Antibody (H00004205-M15)

Find related products by research area.

Blogs on MEF2A

There are no specific blogs for MEF2A, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Samuel Jones
12/18/2021
Application: Immunocytochemistry
Species: Human

Bioinformatics

Gene Symbol MEF2A
Entrez
OMIM
Uniprot