HDAC11 Antibody - Azide and BSA Free

Western Blot: HDAC11 Antibody [NBP3-04908] - Western blot analysis of extracts of various cell lines, using HDAC11 antibody (NBP3-04908) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3s.

• Reactivity: Hu, Mu, Rt
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

HDAC11 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit HDAC11 Antibody - Azide and BSA Free (NBP3-04908) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 270-347 of human HDAC11 (NP_079103.2). GLSISPAGIVKRDELVFRMVRGRRVPILMVTSGGYQKRTARIIADSILNLFGLGLIGPESPSVSAQNSDTPLLPPAVP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HDAC11
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for HDAC11 Antibody - Azide and BSA Free

• EC 3.5.1.98
• FLJ22237
• HD11
• HDAC11
• histone deacetylase 11

Background

Histone deacetylases, such as HDAC11, control DNA expression by modifying the core histone octamers that package DNA into dense chromatin structures and repress gene expression.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HDAC11