Novus Biologicals products are now on bio-techne.com

ISYNA1 Antibody

Images

 
Western Blot: ISYNA1 Antibody [NBP2-47415] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line HEK 293
Immunocytochemistry/ Immunofluorescence: ISYNA1 Antibody [NBP2-47415] - Immunofluorescent staining of human cell line HEK 293 shows localization to nucleus & cytosol.
Immunohistochemistry-Paraffin: ISYNA1 Antibody [NBP2-47415] - Staining of human placenta.
Immunohistochemistry-Paraffin: ISYNA1 Antibody [NBP2-47415] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: ISYNA1 Antibody [NBP2-47415] - Staining of human testis shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: ISYNA1 Antibody [NBP2-47415] - Staining in human testis and liver tissues using anti-ISYNA1 antibody. Corresponding ISYNA1 RNA-seq data are presented for the ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: ISYNA1 Antibody [NBP2-47415] - Staining of human colon, kidney, placenta and testis using Anti-ISYNA1 antibody NBP2-47415 (A) shows similar protein ...read more
Immunohistochemistry-Paraffin: ISYNA1 Antibody [NBP2-47415] - Staining of human colon.
Immunohistochemistry-Paraffin: ISYNA1 Antibody [NBP2-47415] - Staining of human kidney.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ISYNA1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: SVLVDFLIGSGLKTMSIVSYNHLGNNDGENLSAPLQFRSKEVSKSNVVDDMVQSNPVLYTPGEEPDHCVVIKYVPYVGDSKRALDEYTSELMLGGTNTLVLHNTCEDSLLAAPIMLDLA
Predicted Species
Mouse (93%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ISYNA1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ISYNA1 Protein (NBP2-47415PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ISYNA1 Antibody

  • EC 5.5.1.4
  • hINO1
  • hIPS
  • INO1
  • INOS
  • inositol-3-phosphate synthase 1
  • IPSIPS 1
  • MI-1-P synthase
  • MIP synthase
  • Myo-inositol 1-phosphate synthase A1
  • Myo-inositol-1-phosphate synthase

Background

ISYNA1 is a gene that codes for a protein which is a key enzyme in the myo-inositol biosynthesis pathway which works to convert a glucose 6-phosphate into a 1-myo-inositol 1-phosphate, as well as a rate-limiting enzyme in the synthesis of all compounds containing inositol, and is highly expressed in the testis, ovary, heart, placenta, and pancreas. ISYNA1 has three isoforms with lengths of 558, 430, and 504 amino acids and weights of approximately 61, 47, and 55 kDa respectively. Current studies are being done on several diseases and disorders relating to this gene including synostosis, Whipple disease, cerebral palsy, osteonecrosis, bipolar disorder, candidiasis, cerebtitis, osteoarthritis, and malaria. ISYNA1 has also been shown to have interactions with NME2, PPP2CA, RPS15A, CAP2, and EEF2 in pathways such as inositol phosphate metabolism pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-605
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, WB
NBP1-76917
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-39681
Species: Bt, Ca, Eq, Hu, Pm, Mu, Pm, Rb, Rt
Applications: ICC, IHC, IHC-P, IP, WB
NB300-500
Species: Am, Bv, Ca, Dr, Hu, Mu, Po, Rt, Sh
Applications: IHC, IHC-Fr, IHC-P, WB
NB100-689
Species: Hu, Rt
Applications: IHC, IHC-Fr, IHC-P, Simple Western, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
DY417
Species: Mu
Applications: ELISA
201-LB
Species: Hu
Applications: BA
NBP1-76919
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
AF3667
Species: Hu, Mu
Applications: Dual ISH-IHC, ICC, IHC, Simple Western, WB
NBP1-97507
Species: Bv, Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
MAB8930
Species: Hu
Applications: ICC, Simple Western, WB
NBP2-47415
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC

Publications for ISYNA1 Antibody (NBP2-47415) (0)

There are no publications for ISYNA1 Antibody (NBP2-47415).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ISYNA1 Antibody (NBP2-47415) (0)

There are no reviews for ISYNA1 Antibody (NBP2-47415). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ISYNA1 Antibody (NBP2-47415) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ISYNA1 Products

Research Areas for ISYNA1 Antibody (NBP2-47415)

Find related products by research area.

Blogs on ISYNA1

There are no specific blogs for ISYNA1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ISYNA1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ISYNA1