GDF-11/BMP-11 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: GDF-11/BMP-11 Antibody [NBP2-57474] - Staining of human cell line U-2 OS shows localization to vesicles.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GDF-11/BMP-11 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DFQGDALQPEDFLEEDEYHATTETVISMAQETDPAVQTDGSPLCCHFHFSPKVMF
Specificity
Specificity of human GDF-11/BMP-11 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GDF11
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for GDF-11/BMP-11 Antibody

  • BMP11
  • BMP-11
  • BMP-11BMP11Bone morphogenetic protein 11
  • GDF11
  • GDF-11
  • growth differentiation factor 11
  • growth/differentiation factor 11

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1927
Species: Hu
Applications: WB, IP, ICC
355-BM/CF
Species: Hu, Mu, Rt
AF3797
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
NBP1-91612
Species: Mu
Applications: WB
AF339
Species: Hu
Applications: WB, IHC, Block
AF3025
Species: Hu
Applications: WB, ELISA, ICC
AF3444
Species: Hu
Applications: WB
AF1477
Species: Mu
Applications: WB, IHC, Block
MAB5771
Species: Rt
Applications: WB, Flow, CyTOF-ready
NBP1-89917
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
340-RC2
Species: Hu
NBP2-24837
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P
NBP2-57474
Species: Hu, Mu, Rt
Applications: ICC/IF

Publications for GDF-11/BMP-11 Antibody (NBP2-57474) (0)

There are no publications for GDF-11/BMP-11 Antibody (NBP2-57474).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GDF-11/BMP-11 Antibody (NBP2-57474) (0)

There are no reviews for GDF-11/BMP-11 Antibody (NBP2-57474). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for GDF-11/BMP-11 Antibody (NBP2-57474) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional GDF-11/BMP-11 Products

Bioinformatics Tool for GDF-11/BMP-11 Antibody (NBP2-57474)

Discover related pathways, diseases and genes to GDF-11/BMP-11 Antibody (NBP2-57474). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GDF-11/BMP-11 Antibody (NBP2-57474)

Discover more about diseases related to GDF-11/BMP-11 Antibody (NBP2-57474).
 

Pathways for GDF-11/BMP-11 Antibody (NBP2-57474)

View related products by pathway.

PTMs for GDF-11/BMP-11 Antibody (NBP2-57474)

Learn more about PTMs related to GDF-11/BMP-11 Antibody (NBP2-57474).
 

Research Areas for GDF-11/BMP-11 Antibody (NBP2-57474)

Find related products by research area.

Blogs on GDF-11/BMP-11

There are no specific blogs for GDF-11/BMP-11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GDF-11/BMP-11 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GDF11